Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33120-AT1G33140
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Ribosomal protein L6 family
Function (paralog2):Ribosomal protein L6 family

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.14130075362207
Log2 mRNA fold difference:0.12944804802639
Log2 TE fold difference:0.020947982634115
Sequences
Protein sequence

MKTILSSETMDIPDSVTIKVHAKVIEVEGPRGKLVRDFKHLNLDFQLIKDPETGKKKLKI
DSWFGTRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPINASIGGDGKSIEIRNF
LGEKKVRKVEMLDGVTIVRSEKVKDEIVLDGNDIELVSRSCALINQKCHVKKKDIRKFLD
GIYVSEKSKIVEEE

MKTILSSETMDIPDSVTIKVHAKVIEVEGPRGKLVRDFKHLNLDFQLIKDPETGKKKLKI
DSWFGTRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPINASIGGDGKSIEIRNF
LGEKKVRKVEMLDGVTIVRSEKVKDEIVLDGNDIELVSRSCALINQKCHVKKKDIRKFLD
GIYVSEKSKIVEEE

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):585Length 2 (bp):585Length divergence:0
MFE 1 (kcal):-181.89MFE 2 (kcal):-187.59MFE divergence0.015