Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33140-AT4G10450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein L6 family
Function (paralog2):Ribosomal protein L6 family

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.9543043054752
Log2 mRNA fold difference:-2.368131487398
Log2 TE fold difference:0.41699013562041
Sequences
Protein sequence

MKTILSSETMDIPDSVTIKVHAKVIEVEGPRGKLVRDFKHLNLDFQLIKDPETGKKKLKI
DSWFGTRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPINASIGGDGKSIEIRNF
LGEKKVRKVEMLDGVTIVRSEKVKDEIVLDGNDIELVSRSCALINQKCHVKKKDIRKFLD
GIYVSEKSKIVEEE

MKTILSSETMDIPDGVAIKVNAKVIEVEGPRGKLTRDFKHLNLDFQLIKDQVTGKRQLKI
DSWFGSRKTSASIRTALSHVDNLIAGVTQGFLYRMRFVYAHFPINASIDGNNKSIEIRNF
LGEKKVRKVEMLDGVKIVRSEKVKDEIILEGNDIELVSRSCALINQKCHVKKKDIRKFLD
GIYVSEKGKIAVEE

www.000webhost.com

Other information
Ka divergence:-0.200265KaKs divergence:0.0446602
GC content 1 (%):47GC content 2 (%):40GC content divergence:-0.08
Length 1 (bp):585Length 2 (bp):585Length divergence:0
MFE 1 (kcal):-187.59MFE 2 (kcal):-172.1MFE divergence-0.043