Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33230-AT4G10430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TMPIT-like protein
Function (paralog2):TMPIT-like protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.63871321322849
Log2 mRNA fold difference:-0.54772105984752
Log2 TE fold difference:0.94798116015387
Sequences
Protein sequence

MEEVEEEVRRIVEQVKELHDSSTSFVSSSSQEELSLRNRASVVDSSIRRLHSTLASDKHL
DPKLFEKLEEDLQRARCMLADGDTSSFLPSKPQGRFVRMFLGPVNVRASRKDIQLKVKEE
YNSYRDRTALLFLVFPAILLTLRSYVWDGCLPAFPVQLYQAWLLFLYAGLVMRENILRAN
GSDIRSWWLYHHYFAMAMSLVSLTWEIKGQPNCVQKQKGVRLFLQWAMMQGVAMLLQNRY
QRQRLYTRIALGKAKRMDVVWGETAGVDGQLLLLFPILFTLQGFEAYVGFQLLRTVLMGV
VAEWQVLVCGILLVVMAIGNFINTVETLMVKSRFKAKMKRSKSRAEL

MEVEEEVKQIIDEVKELHDSAASFISSSSQQELSLRQKASAVDSSIRRLHSTIVSNKNLD
PKLVEKLEEDLHRARCMLVDGETSSFLPSKPQGRFVRMFCGPVNVRALRKDVQLKVKEEY
NRYRDKTALLFLFFPATLLILRSYYWGGCLPAFPVQLYEAWLLFLYAGLAMRENILRANG
SDIRPWWLYHHYCAMAMALVSLTWEIKGQPNCVQKQRGVHLFLQWAMMQGVAMLLQNRYQ
RQRLYTRIALGKAKRMDVVWGETAGVDGQLWLLCPILFILQVFEAYVGLLLLRKTVTGVV
NEWQVMVCGILLVVMAVGNFINTVETLMAKSRVKAKMKRSKSRAELN

Other information
Ka divergence:0.00795997KaKs divergence:0.394547
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1044Length 2 (bp):1044Length divergence:0
MFE 1 (kcal):-305MFE 2 (kcal):-300.98MFE divergence-0.007