Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33260-AT4G10390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.32893825237756
Log2 mRNA fold difference:-0.38066993953295
Log2 TE fold difference:-0.013463212409892
Sequences
Protein sequence

MSCFLSCVRFETTTDNNKPTSTESGSVSGVTCYTWDDVESLTSNFSRLIGTGGYSSIYLA
RVSGSINAALKVHVSSHRLYQVFRSELEILLRLQHPHIVKLLGYFDDSEESGALLLEYLP
QGNLQEKLNRNSKQVLPWRNRTAIAFQVAQAIEHIHEKCSPQIVHGDIKSSNILLDKHFN
SKLCDFGSAKVGFSSMVQPSKTTSTMSPRSKQVMMIGSPGYTDPHYLRTGIASKKMDMYG
FGVVVLELVSGKEAVSSERGEMLVHSTASLIHEILDSNGDIGEEKVRQFLDPRLSRDGSI
DLEEVKTMLRVAAFCLRSPPSLRPSASQVVQTLNKKIPSLSFLGCGKKE

MACFLNCVRFDVSKTITDKPTSQGSGVTCYNSWDDVETLTSNFSRLIGSGGYSSIYMARF
SGSDKAALKVHVSSHRLYQVFRLELDILLRLQHPNIVKLLGYFDDSEENGALLLEYLPQG
NLQEKLQSNSKQVLQWRNRVAIALQLVQAIEHIHEKCSPQIVHGDIKSSNVLLDKNFDCK
LCDFGSAKVGFSSMVQPPTMSPRSRQVKMVGSPGYTDPHYLRTGIASKKMDMYGFGVVVL
ELVSGKEAFSAERGEMLVHIAAPLMNEILDSSVDISEDKVRQFLDPRLLRDSLDIDEVKT
MLSVAAVCISSKLSLRPSAAQVADTLIKEIPSLSFLGCGKGV

Other information
Ka divergence:0.369316KaKs divergence:0.593134
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1050Length 2 (bp):1029Length divergence:-0.01
MFE 1 (kcal):-308.45MFE 2 (kcal):-311.02MFE divergence0.004