Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33280-AT4G10350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NAC domain containing protein 15
Function (paralog2):NAC domain containing protein 70

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.61686967743321
Log2 mRNA fold difference:0.16379059260439
Log2 TE fold difference:-0.54095625876268
Sequences
Protein sequence

MSSSNGGVPPGFRFHPTDEELLHYYLKKKISYEKFEMEVIKEVDLNKIEPWDLQDRCKIG
STPQNEWYFFSHKDRKYPTGSRTNRATHSGFWKATGRDKCIRNSYKKIGMRKTLVFYKGR
APHGQKTDWIMHEYRIEDTEDDPCEDGWVVCRVFKKKNLFKVGNDVGSNISNNRLEARSF
IRRESPYQGISMFELNKPEEISVHQYPQPPMFQPHHKPLSIGYDYSLALLPRESEYQQAC
QPSGVEVGTCKAVSEWGIVNCNMVSHEDSSRAMRFEDDGNNTSSTVQPPSNLLSLRGENG
FLGLF

MGSSSNGGVPPGFRFHPTDEELLHYYLKKKISYQKFEMEVIREVDLNKLEPWDLQERCKI
GSTPQNEWYFFSHKDRKYPTGSRTNRATHAGFWKATGRDKCIRNSYKKIGMRKTLVFYKG
RAPHGQKTDWIMHEYRLEDADDPQANPSEDGWVVCRVFMKKNLFKVVNEGSSSINSLDQH
NHDASNNNHALQARSFMHRDSPYQLVRNHGAMTFELNKPDLALHQYPPIFHKPPSLGFDY
SSGLARDSESAASEGLQYQQACEPGLDVGTCETVASHNHQQGLGEWAMMDRLVTCHMGNE
DSSRGITYEDGNNNSSSVVQPVPATNQLTLRSEMDFWGYSK

www.000webhost.com

Other information
Ka divergence:-0.359275KaKs divergence:0.0111343
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):918Length 2 (bp):1026Length divergence:0.056
MFE 1 (kcal):-271.14MFE 2 (kcal):-298.3MFE divergence0.048