Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33590-AT1G33600
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Leucine-rich repeat (LRR) family protein
Function (paralog2):Leucine-rich repeat (LRR) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0883208829574
Log2 mRNA fold difference:-1.7131750410954
Log2 TE fold difference:-0.40166736726979
Sequences
Protein sequence

MNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACC
SWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQ
FLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLK
LGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPP
SIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNL
DLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDD
WKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLD
ISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSPCKA

MNSCCFPLFIFAFVIFLRCLSPIEAATCHPDDEAGLLAFKSGITQDPTGILSSWKKGTDC
CSWKGVGCLTNRVTGLTINGQSDVTGSFLSGTISPSLAKLQHLVGIYFTNLRNITGSFPQ
FLFQLPNVKQVYFTNSRLSGPLPANIGALSELGELSLDGNLFTGPIPSSISNLTRLYLLN
LGDNLLTGTIPLGLANLKILLSLNFGNNRLSETIPDIFKSMQKLQSLTLSRNKFSGNLPP
SIASLKPILNYLDLSQNNLSGTIPTFLSNFKVLDSLDLSRNRFSGVVPKSLANMPKLFHL
NLSHNFLTGPLPAMKNVDGLATLDLSYNQFHLKTIPKWVTSSPSMYSLKLVKCGINMSLD
NWKPVRPNIYFYIDLSENEISGSLTWFFNLAHNLYEFQASGNKLRFDMGKLNLSERLESL
DLSRNLIFGKVPMTVAKLQKLNLSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSPCKI

Other information
Ka divergence:0.416684KaKs divergence:-0.176368
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):1434Length 2 (bp):1437Length divergence:0.001
MFE 1 (kcal):-414.77MFE 2 (kcal):-380.31MFE divergence-0.043