Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33680-AT4G10070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):KH domain-containing protein
Function (paralog2):KH domain-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.4808277610006
Log2 mRNA fold difference:-1.8464778079836
Log2 TE fold difference:0.3700177204866
Sequences
Protein sequence

MAEEEVIAIPVQPSDHKRKLENLESEILEQQHAGSIDNDVSVDDDKNASDYCQPKRPKLD
DEAVDGLGIGGTVENSGDVESKEEGTEKPIAQSDENQDGNPLIEKVQETIDAEESDNKME
DNGKPEDNQLVTPEVVTSQDVSVEESKEVNISGSQNEGEDDSKETNDVVAQKEVENGSKE
VTDCDSQKEDEANAGGESKEVNGSVSHDEIGDESKEVNGGSTHKEVDDTQSTTRRIDVPS
SKVGTLIGKGGEMVRYLQVNSGAKIQIRRDAEADPSSALRPVEIIGTVSCIEKAEKLINA
VIAEVEAGGVPALAARGVPEQMEIKVPSDKVGVIIGRGGETIKNMQTKSRARIQLIPQNE
GDASKERTVRISGDKRQIDIATALIKDVMYQDGRPSPYSGGFNQQAYQPRGPGGPPQWGS
RGPHGPHSMPYNYHHGGPYPSQGSHFRPPNSGGYPPQHMPPRSGYGSGWEQRPPHSGPYD
YYGRQGGQNPGPVPSHGASYSQAGAQQTYGQMYDQPHYDNPPMHQSYGGYGGSQQGYPSA
GGQHQMQQPSRPYGMQGSAEQGYGPPRPAAPPGDVPYQGPTPAAPSYGSTPAAASYGSTP
AAPSYGSTPAAPSYGSNMAQQQQYGYASSAPTQQTYPSYSSAAPSDGYNGTQPPAVAPAY
EQHGAQPASGVQQTSGGYGQVPPTGGYSSYPSTQPAYGNTPAQSNGNYGYIGSQYPSYGG
GNASAYAAPTGQTAYSQTAPPQAGYEQSATQSAGYAAAPGTAQ

MTEEDFVVISTPPVDLKRKLDEVELNGNIVDDSNQTSDSSQAKRAKLEDEAQDGLDYGNT
QENGSSMEVKEEEQLQEPKEENQDSVPLVEEVQDPIHADESENKICSVDQPTDDQVKPED
NQQGCIEDVNGGEHQKVIDDDSKEVNDGSSQENGKEENKEVDGEKSQKEVDGTQSTTRRI
DVPSSKVGVLIGKGGETIRYLQFNSGAKIQILRDSEADPSSALRPVEIIGSVACIESAEK
LISAVIAEAEAGGSPALVARGHPSTHAIGIPEQIEIKVPNDKVGLIIGRGGETIKNMQTR
SGARTQLIPQHAEGDGLKERTVRISGDKMQIDIATDMIKDVMNQNARPSSYSGGYNQPAY
RPQGPGGPPQWGSRGPHAPHPYDYHPRGPYSSQGSYYNSPGFGGYPPQHMPPRGGYGTDW
DQRPPYSGPYNYYGRQGAQSAGPVPPPSGPVPSPAFGGPPLSQVSYGYGQSHGPEYGHAA
PYSQTGYQQTYGQTYEQPKYDSNPPMQPPYGGSYPPAGGGQSGYYQMQQPGVRPYGMQQG
PVQQGYGPPQPAAAASSGDVPYQGATPAAPSYGSTNMAPQQQQYGYTSSDGPVQQQTYPS
YSSAPPSDAYNNGTQTPATGPAYQQQSVQPASSTYDQTGAQQAAAAGYGGQVAPTGGYTY
PTSQPAYGSQAAYSQAAPTQTGYEQQPATQAAVYATAPGTAPVKTQSPQSAYAQYDASQV
YATPR

Other information
Ka divergence:-0.0371189KaKs divergence:0.0607781
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):2292Length 2 (bp):2178Length divergence:-0.026
MFE 1 (kcal):-773.3MFE 2 (kcal):-704MFE divergence-0.047