Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33700-AT4G10060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Beta-glucosidase, GBA2 type family protein
Function (paralog2):Beta-glucosidase, GBA2 type family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.3059385908886
Log2 mRNA fold difference:2.4481596627356
Log2 TE fold difference:-1.2315927653781
Sequences
Protein sequence

MQNVPEDQNKMVIDDKLPPFSWERKLNSQAKTPSEFKLSKRDHMHLFPLGYRLWRHTKDE
AAKGRASIFDIFRKHHITGDHGVPLGGIGSGSIGRSYKGEFQQFKLFPKICEEAPILTNQ
FSAFVSRPGGVKHSTVLCPSKPQVVKDNGGYLCQGQAPNMGIESWDWNMTGEKSTYHALY
PRSWTVYDGEPDPELRIVSRQVSPFIPHNYEESSLPVSVFNFTVTNTGAEPAIVTLLFTW
ENSVGGASGLTGQHFNSTMKAKDGVHAVALQHKTANGHPPVSYAIAAKETEDVRVSSCPC
FIVSGTTPNQITAGDMWDEIKKNASFDKLTSNACSPSKPGTSIGAAIAAKVKVPPGCDRT
VTFSLSWDCPEARFDEKTYHRRYTRFYGSLGNAAVAMAHDALLNFPEWETQIEEWQAPVL
ADTTLPEWYRVTLFNELYYFNSGGTMWTDGLPPKQSLDSIGRRKISLGLSTIDKNDQDQN
NVALDILGRIDAVCSQIHAPLTSNAALGNTMIQNTTENIGQFLYLEGVQYLMYNTYDVHF
YSSFALLMLFPKIELSIQRDFAAAVLMHDSSKKQVMSSGEFVTRKVLGAVPHDIGLNDPW
FELNAYNLFNTDRWKDLNSKFVLQVYRDVVATGDLNFAKAVWPSVYTAIAYLDQFDKDGD
GMIENEGFPDQTYDAWSCSGVSAYCGGLWVAALQAGSALAREIGDNGAAVYFNAKYEKAR
SVYEKLWNGSYFNYDNSRSGSSSSILADQMAGQWYARACGLKPIAKEEWIKKALETVYDF
NVMRVRDGTRGAVNGMLPDGRVDTSTMVSREVWAGTTYSVAACMIQEGLADKGFRTASGI
YEAAWSDRGLGCAFQTPEAWTTNDEYRSLCYMRPLAIWGIQWAHTMPKPNREQEVSLRPQ
EEDATSVLFQQHAGFIKVAHYLKNTKGKDHRNRLQTAYETFLKTIRL

MEKNGHTESELQTQMVGNERLPQVTWQRKLNSKVKNPSEFKMSIRDVLHLFPLGYRLWRY
TKEEAKKGRFSMYDIFKKRHVRGDHGVPLGGIGGGSIGRSYKGEFQQFKLFPKICEEAPI
LTNQFSVFVSRPGGLSYSTVLCPTKPKSVKGKTEDLGIESWDWNMEGDKSTYHALYPRSW
TVYNEPDPELRIVSRQVSPFIPHNYKESSLPVSVFEFTMSNLGKEEATVTLLFTWENSVG
GASGLTGEHFNSTIMERDGVHAIVLHHKTGNGHPPVTYAIAAQETEDVHVSECPCFLVSG
HSPKEITAKEMWDEIKKNKSFDELNSEPGSPSRPGTSIGAAIAAKVKVPPGCDRTVTFSL
SWDCPEVRFNEKTYHRRYTKFYGNLGDAAVKMARDALLNYVDWESQIEAWQSPILSDTTL
PDWYRVTLFNELYYFNSGGTIWTDGLPPKESIERSKVTNTEQNDIVIDLFQKINAVCEQI
YSPQSSNSEENIGQFIYLEGIEYLMYNTYDVHFYSSFALLSLFPKLALSIQRDFAATVLI
QDPTKKKIMSSGEWVTRKLLGSVPHDIGLNDPWLELNEYNFFNTDRWKDLNAKFVLQVYR
DVVATNDQSFAKAVWPSVYTAVAYLDQFDKDEDGMIENEGFPDQTYDAWSVTGVSAYCGG
LWVAALQAASAFASIVGENAVAIYFNAKYEKAKIVYEKLWNGSYFNYDDSGSGSSSSILA
DQLAGQWYARACGLKPITKEEWIKKALETIYEFNVMKVKGGTRGAVNGMSTEGKVDTNSL
VSKEVWAGTTYSVAACMIQEGQREKGFQTASGIYEAIWSDRGLSCSFQTPEAWNMNDEYR
SLCYMRPLAIWAIQWALTRTQSFGEEKQKLVAGDEEEESNLLLRQHKGFKDVARFVKIVP
TSNVHRSRLQHTYETVLKTLRL

Other information
Ka divergence:0.167451KaKs divergence:0.290784
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):2844Length 2 (bp):2769Length divergence:-0.013
MFE 1 (kcal):-876.96MFE 2 (kcal):-818.37MFE divergence-0.035