Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33800-AT4G09990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF579)
Function (paralog2):Protein of unknown function (DUF579)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.67246595370255
Log2 mRNA fold difference:-0.0097345928680494
Log2 TE fold difference:-0.66349573457036
Sequences
Protein sequence

MRTKSPSSLNLKVIFIGSSILILIIIYLARSNISSSSSKPISKTNLSQEEEETQHKQEGC
PTTQQCTKMPLSLSDALVHYVTSNVTPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLM
WASLNHGGRTLFIEEDQAWIAIVTKKFPNLESYHVVYDTKVKDSDKLMELGRSEECRSVS
DPRNSKCDLALKDFPADFYETKWDLIMVDAPTGYHEEAPGRMSAIYTAGLLARNREDGET
DVFVHDVNRPVEDEFSATFLCKGYMREQNGRLRHFTIPSHRARAGRPFCPVEVDRRR

MRNKSQSFISSKLIFICCSILVLFILFLKRASFSSNSTATIRDEYHQKSKCPSTPQQCTK
LPTSLSDALVHYVTSEITPQQTFDEVSVSKRVLDKKSPCNFLVFGLGHDSLMWASLNHGG
RTLFLEEDEAWIETVTKKFPNLESYHVVYDTKVKDSNKLMELKRTEDCKAVSDPRDSKCA
LSLKGFPADVYETQWDVIMVDAPTGYHDEAPGRMSAIYTAGLLARNRYDGGETDVFVHDI
NRPVEDEFSVAFLCGGYMKEQQGRLRHFNIPSHRASFGTPFCPADISRRF

Other information
Ka divergence:0.275672KaKs divergence:-0.999817
GC content 1 (%):43GC content 2 (%):46GC content divergence:0.034
Length 1 (bp):894Length 2 (bp):873Length divergence:-0.012
MFE 1 (kcal):-240.27MFE 2 (kcal):-257.99MFE divergence0.036