Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33970-AT4G09950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.0201151046913
Log2 mRNA fold difference:-2.0768320495094
Log2 TE fold difference:-0.93712145348497
Sequences
Protein sequence

MSLLDMGGDMMEDDWEFASSSNPKRTLVLVGRTGNGKSATGNSILGRKAFRSRARTVGVT
STCESQRVVQEDGDIINVVDTPGLFDLSTAADFIGKEIVRCISLAEDGIHAILLVFSVRR
LAEEEQTVLSFLQALFGSKIADYMIVVFTGGDELEENEETLEEYLADYCPEFLKEILGIC
DNRLVLFNNKTTDKVKKAEQVQKLLSLVESVVKQNNGKPYSDELFHELQEEAIKLRDQKK
EVELLQGYSNNEIDEFKKQIDMSYDRQLSRITEMVETKLRDTAKRLEQQLGEEQAARLEA
EKRANEVQKRSSDEIKKLRENLERAEKETKELQKKLGKCINL

MVVDSSALNVENDWKPERTLVLLGRTGNGKSATGNSILGKTMFQSKARGKFITKECKLHK
SKLPNGLTINVIDTPGLFSASSTTDFTIREIVRCLLLAKGGIDAVLLVFSLRNRLTEEEQ
STLRTLKILFGSQIVDYIIVVFTNEDALECGETLDDYLEDCPEFQEILEECDDRKVLFDN
SYNAPVSKKDRQVHDLLNLVEQISKKNNGKSYMADLSHELRENEATIKEKQKQIEEMKGW
SSKQEISQMKKELEKSHNEMLEGIKEKISNQLKESLEDVKEQLAKAQAEREETEKKMNEI
QKLSSDEIRRLREQLNKAEKETASLRTELNKKCTVL

Other information
Ka divergence:0.482185KaKs divergence:0.408195
GC content 1 (%):43GC content 2 (%):39GC content divergence:-0.049
Length 1 (bp):1029Length 2 (bp):1011Length divergence:-0.009
MFE 1 (kcal):-296.65MFE 2 (kcal):-250.12MFE divergence-0.085