Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G33990-AT4G09900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):methyl esterase 14
Function (paralog2):methyl esterase 12

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.7770749432006
Log2 mRNA fold difference:-1.8633048700152
Log2 TE fold difference:0.11666936800782
Sequences
Protein sequence

MGNKIISMMKKDSKDGGGGGSKSKRMNRSQRKLLADEEMLHRRALSMAIHQAQLSQRFDG
SMSRRVGSTSTRKRTLSDPFSNGKQVPDFSESLIVKKFVLVHGEGFGAWCWYKMVASLEE
SGLSPVTVDLTGCGFNMTDTNTVSTLEEYSKPLIDLLENLPEEEKVILVGHSTGGASISY
ALERFPEKISKAIFVCATMVSDGQRPFDVFSEELGSAERFMKESQFLIYGNGKDKPPTGF
MFEKPHMKGLYFNQSPNKDIALAMISMRPVPLGPMMEKVSLTAERYGKGRRFYVQTLDDR
ALSPDVQEKLVRENSPEGVFKIKGSDHCPFFSKPQSLHKILLEIAQIP

MGNRVICMKKKDVVIRSGGDGSRSKRVNRSQRKLLADEENLHRRALSMAIHQAQVSQRFD
GSMSRRIGSTSSRRGTLSDSFSNNKQVPEFLESLKVKKFVLVHGEGFGAWCWYKTIASLE
ESGLSPVTVDLAGSGFNMTDANSVSTLEEYSKPLIELIQNLPAEEKVILVGHSTGGACVS
YALERFPEKISKAIFICATMVTDGQRPFDVFADELGSAERFMKESQFLIYGNGKDNPATG
FMFEKQHMKGLYFNQSPNKDIALSMISMRPVPLGPMMEKLSLSAERYGKGRRFYVQTLDD
LALSPDVQEKLVRENSPEAVFKIKGSDHCPFFSKPQSLHKILLEIAQIP

www.000webhost.com

Other information
Ka divergence:0.0849702KaKs divergence:0.0791826
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1047Length 2 (bp):1050Length divergence:0.001
MFE 1 (kcal):-313.2MFE 2 (kcal):-316MFE divergence0.004