Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G34020-AT4G09810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotide-sugar transporter family protein
Function (paralog2):Nucleotide-sugar transporter family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.7732616699409
Log2 mRNA fold difference:-1.8158093796526
Log2 TE fold difference:0.046023277589892
Sequences
Protein sequence

MAPVSKADKKAAVDAAAWMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTL
VLRCLGYIQPSHLPFTELLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEM
VFDKIRYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRK
YSLNSFNLLGHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTN
LSQFICIGRFTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNA
SSKPGGKERRNYSLPTTRQQKLGAASDSDDNEDKA

MAPVKKSDKKATLDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTL
VLRCLGYIQPSHLPFTELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV
VFDKIRYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRK
YSLSSFNLLGHTAPAQAATLLIVGPFLDYWLTDKRVDMYDYNSVSVMFITLSCTIAIGTN
LSQFICIGRFTAVSFQVLGHMKTILVLVMGFFFFDRDGLNLHVILGMIIAVLGMIWYGNA
SSKPGGKEKKNYSLPTTRQQKLGATSDSDEHRDKA

Other information
Ka divergence:0.212625KaKs divergence:0.110196
GC content 1 (%):43GC content 2 (%):40GC content divergence:-0.036
Length 1 (bp):1008Length 2 (bp):1008Length divergence:0
MFE 1 (kcal):-301.57MFE 2 (kcal):-281.2MFE divergence-0.035