Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G34040-AT1G34060
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Pyridoxal phosphate (PLP)-dependent transferases superfamily protein
Function (paralog2):Pyridoxal phosphate (PLP)-dependent transferases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.8430683164789
Log2 mRNA fold difference:-2.2032713528701
Log2 TE fold difference:-0.54420788635684
Sequences
Protein sequence

MIHNKLLIAGSIILNLVFTIHILYNNTSTWSPTWTNRAALEAEAAASVSCSGHGRSYVDG
LGVLDGHKPCECHDCYTGKDCSVLLKDCPVDANSGDPLFLEPFWIRKAEESAVVESGWHR
MSYTFNGYGLFMSAELEKIIRKLHNVVGNAVTDNRFIIFGAGATQLLAASVHALSQTNSL
SPSRLVTSVPYYNLYKQQADFFNSTNLKFEGDASAWKRSERNDDIKQVIEIVTSPNNPDG
KLKRAVLDGPNVKYIHDYAYYWPYFSPITRQADEDLSLFSLSKTTGHAGSRFGWALVKEK
TVYEKMKIYISLSSMGVSRDTQLRALQLLKVVIGDGGNEIFRFGYGTLKKRWEILNKIFS
MSTRFSLETIKPEYCNYFKKVREFTPSYAWVKCERPEDTDCYEIFKAAKITGRNGEMFGS
DERFVRLSLIRSQDDFDQLIAMLKKFVSKEAVVVDSI

MMQKKLLLIVSIILNLVFTIHILYYSSTTWNPTWTNRAAAEAETVASFSCSGHGRAFVDG
LGVLDGQKPPCECNNCYIGKDCSVLLKDCPVDANSGDPLFLEPFWMRQAERSAILVSGWH
RMSYIYEDGTYVSRELEKVIRKLHSVVGNAVTDNRFVIFGSGTTQLLAAAVHALSLTNSS
VSSPARLLTSIPYYAMYKDQAEFFDSAHLKFEGNASAWKQSGRNDNITQVIEVVTSPNNP
DGKLKRAVLDGPNVKTLHDYAYYWPHFSPITHPVDEDLSLFSLSKTTGHAGSRFGWGLVK
DKAIYEKMDRFIRLTSMGVSKETQLHVLQLLKVVVGDGGNEIFSFGYGTVKKRWETLNKI
FSMSTRFSLQTIKPEYCNYFKKVREFTPSYAWVKCERPEDTNCYEIFRAAKITGRNGNVF
GSEERFVRLSLIRSQDDFDQLIAMLKKLVYHEEDVPSENFMYI

www.000webhost.com

Other information
Ka divergence:0.0585317KaKs divergence:0.636602
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1374Length 2 (bp):1392Length divergence:0.007
MFE 1 (kcal):-383.12MFE 2 (kcal):-402.07MFE divergence0.024