Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G34180-AT1G34190
Species:Arabidopsis
Duplication type:TD
Function (paralog1):NAC domain containing protein 16
Function (paralog2):NAC domain containing protein 17

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.2018250127612
Log2 mRNA fold difference:3.2137841744123
Log2 TE fold difference:-0.046907301790824
Sequences
Protein sequence

MVDSSRDSCFKAGKFSAPGFRFHPTDEELVVYYLKRKICCKKLRVNAIGVVDVYKVDPSE
LPGNFQHLLIDFDSCLSMLKTGDRQWFFFTPRNRKYPNAARSSRGTATGYWKATGKDRVI
EYNSRSVGLKKTLVFYRGRAPNGERTDWVMHEYTMDEEELGRCKNAKEYYALYKLYKKSG
AGPKNGEQYGAPFQEEEWVDSDSEDADSVAVPDYPVVRYENGPCVDDTKFCNPVKLQLED
IEKLLNEIPDAPGVNQRQFDEFVGVPQGNSAEVIQSTLLNNSSGEYIDPRTNGMFLPNGQ
LYNRDSSFQSHLNSFEATSGMAPLLDNEKEEYIEMNDLLIPELGASSTEKSTEFLNHGEF
GDVNEYDQLFNDISVFQGTSTDLSCLSNFTNNTSGQRQQLLYEQFQYQTPENQLNNYMHP
STTLNQFTDNMWFKDDQAALYVQPPQSSSGAFTSQSTGVMPESMNPTMSVNPQYKEGQNG
GGTRSQFSSALWELLESIPSTPASACEGPLNQTFVRMSSFSRIRFNGTSVTSRKVTVAKK
RISNRGFLLLSIMGALCAIFWVFKATVGVMGRPLLS

MADSSPDSCFKGGKFSAPGFRFHPTDEELVMYYLKRKICRKRLRVNVIGVVDVYKMDPEE
LPGQSMLKTGDRQWFYFTPRSRKYPNAARSNRGTENGYWKATGKDRVIEYNSRSVGLKKT
LVFYRGRAPSGERTDWVMHEYTMDEDELGRCKNPQEYYALYKLFKKSGAGPKNGEQYGAP
FQEEEWVDDDNEDVNAIAVAVPEQPVVRYEDARRVDERRLFNPVILQLEDIDELLNGIPN
APGVPQRCIPQVNSEEELQSTLVNNSAREFLPNGQQYNRPSSFDSLETAEVTSAPLVFEK
EDFIEMDDLLLIPEFGASSTEKAAQFSNHGEFDDFNEFDQLFHDVSMSLDMEPIDQGTSA
NLSSLSDSANYTSDQKQQLLYQQFQDQTPENQLNNIMDPSTTLNQITSDIWFEDDQAILF
DQQQSFSGAFASPSSGVMPDSTNPTMSVNAQGHEIQNGGGTTSQFSSALWALMDSIPSTP
ASACEGPLNRTFVRMSSFSRMRFNGKANGTPVSTTIAKKGIRNRGFLLLSIVGALCAIFW
VLVATVRVSGRSLLLKD

Other information
Ka divergence:-0.217221KaKs divergence:-0.0663616
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1731Length 2 (bp):1674Length divergence:-0.017
MFE 1 (kcal):-527.18MFE 2 (kcal):-511.83MFE divergence-0.015