Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G34200-AT4G09670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glyceraldehyde-3-phosphate dehydrogenase-like family protein
Function (paralog2):Oxidoreductase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.079461736856
Log2 mRNA fold difference:1.6181588331773
Log2 TE fold difference:-0.62640825500814
Sequences
Protein sequence

MSGDNQIRIGLLSCTNKVRKLSRAINLSPNATISAIATTSSIEEAKSFAKSNNFPPNTKL
HSSYESLLEDPDVDAVYFPIPTRLHVEWATLAAIKGKHILLDKPVALNVAEFDQIVEACE
VNGVQFMDGTQWMHSPRTDKIKEFVNDLESFGQIKSVYSCFSFAASDDFLKHDIRVKPGL
DGLGALGDAGWYTIQAILLVNNFKLPKTVTALSGSVLNDAGIVLSCGALFDWEDGVNATI
YCSFLANLTMEITAIGTKGSLRVHDFVIPYMETEAVFTTSGGGCVSEHKVMTELSQEACM
VMEFARLVGEIKNRGAKPDGFWMRFSRNTQLLVDAVKESIDNNLEPVFLSGR

MATETQIRIGVMGCADIARKVSRAIHLAPNATISGVASRSLEKAKAFATANNYPESTKIH
GSYESLLEDPEIDALYVPLPTSLHVEWAIKAAEKGKHILLEKPVAMNVTEFDKIVDACEA
NGVQIMDGTMWVHNPRTALLKEFLSDSERFGQLKTVQSCFSFAGDEDFLKNDIRVKPGLD
GLGALGDAGWYAIRATLLANNFELPKTVTAFPGAVLNEAGVILSCGASLSWEDGRTATIY
CSFLANLTMEITAIGTKGTLRVHDFIIPYKETEASFTTSTKAWFNDLVTAWVSPPSEHTV
KTELPQEACMVREFARLVGEIKNNGAKPDGYWPSISRKTQLVVDAVKESVDKNYQQISLS
GR

Other information
Ka divergence:-0.475915KaKs divergence:-0.444947
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1059Length 2 (bp):1089Length divergence:0.014
MFE 1 (kcal):-303.7MFE 2 (kcal):-341.25MFE divergence0.058