Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G34470-AT4G09640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF803)
Function (paralog2):Protein of unknown function (DUF803)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.19448884370949
Log2 mRNA fold difference:0.70792236773861
Log2 TE fold difference:-0.4833268473363
Sequences
Protein sequence

MASLSGSWRDAYKGMSSDNIKGLVLALSSSLFIGASFIVKKKGLKRAGASGLRAGSGGYS
YLLEPLWWVGMITMIVGEIANFAAYAFAPAILVTPLGALSIIISAALAHVILHEKLHTFG
LLGCVLCVVGSITIVLHAPQEQEIDSVLQVWNLATEPAFLLYAAAVVGAAIILIVQFVPQ
YGQSHVMVYIGVCSLVGSLSVMSVKALGIALKLTFSGMNQLIYPQTWVFTLIVLTCVITQ
MNYLNKALDTFNTAVVSPIYYVMFTSLTILASVIMFKDWDRQDGTQIVTELCGFVTILSG
TFLLHKTKDMVDGSSSLGNLALRLPKQLEDSNGFEQEGIPLTLRRHECTKSPRPMRQFIL
PQDGPEAV

MVYSSGSWRDAYKGMSSDNVKGLVLALSSSIFIGASFIVKKKGLKKAGASGLRAGSGGYS
YLLEPLWWIGMITMIVGEIANFAAYAFAPAILVTPLGALSIIISASLAHIILQEKLHTFG
ILGCALCIVGSVTIVLHAPQEQDIVSVLEVWNLATEPAFLFYAAAVVGAAIVLIVQFIPL
YGQSHVMVYIGVCSLIGSLSVMSVKALGIALKLTFSGTNQLGYPQTWVFTVIVLFCVITQ
MNYLNKALDTFNTAVVSPIYYVMFTSLTILASVIMFKDWDRQSGTQIMTELCGFVTILSG
TFLLHTTTDMVDGESKGNLSSEEDSHLLLRIPKHSEDSNGFVQDGIILSLRRQESAKSPR
PARQNKQLEDDLEAVPLRRQESSLRS

www.000webhost.com

Other information
Ka divergence:0.241539KaKs divergence:0.201928
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1107Length 2 (bp):1161Length divergence:0.024
MFE 1 (kcal):-323.98MFE 2 (kcal):-327.28MFE divergence0.005