Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G34550-AT4G09630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF616)
Function (paralog2):Protein of unknown function (DUF616)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.30307151006079
Log2 mRNA fold difference:0.39823794552937
Log2 TE fold difference:-0.072175193073719
Sequences
Protein sequence

MVNVLAFLPDELREKLIDEQETREKFQRLHSYVHALSTEVAMKRFYGALTTKEGISGSGV
NATSDWGSYVTELSSLLEKSPKIERVLIDDDNAKMAQFRQSGTDRFSVRGNGGGASSDHV
TIGIRNGVGGATKGNNNRWRRSVRADKIRRLGIGSVVFVLCFVLLVTVLAYCYISGFTYN
SYDDKGFVDSYEGDFLTNVTRLDPSKVLEFGQGSVIHGRDSRYWDKDDRRRDDDYNEDEV
KKDVQQVHNPVKGIGLYNEAGRNELKMYEAEYKATLGKGGHEKNNEGVDRDREDDDAIDS
HDGDEYVDSGHEDDNEEVHKEKVVHLVTKQENVDKDDGGVSKMSLGDSSLVSKGGKSGKT
SRSDTKRRGRRRSSGSCEMKLLNSSQPIVEPLNTRKSARFSLQYIEKEDKPDEEEQWEPR
FAGHQSLQEREDSFVAQDKKIHCGFVKGPKGSSSTGFDLTEDDTNYISRCHIAVSSCIFG
NSDRLRPPANKMISRLSRKNVCFIVFVDEITMQTLSAEGHAPDRAGFIGLWKLVVVKNLP
YADMRRVGKIPKMLPHRLFPSARYSIWLDSKLRLQLDPLLILEYFLWRKGHEYAISNHYD
RHCLWEEVAQNKKLNKYNHTVINQQFQFYKADGLTRFNASDPFKLLPSNVPEGSFIVRAH
TPMSNLFSCLWFNEVERFTPRDQLSFAYTYQKLRRMNPDKPFNLHMFKDCERRKIAKLFR
HRSDEKRNLIQAAIQ

MAQYRQSGTERFLGGRSGYNPYVNGGASSDHVAIGIRNGGGSNFGVVTQHGKASRWRRST
RLDRNRRCGVGSLVFVLCVVLVVCVSAYYYFSGYTNFGKDDKGIDTAEGDFLTNVSRTDP
LKILKFGHGSVLHGRDSRDWDKDDRRRDEDYNEDDVEDKSVVEERSVSEVKKDVSLRNPL
KGSDWKGVGFYNEAGRDELKKYEVEYQASLVKGGQSLKENDGHHQPFDTESNEDDSIDSH
DTQGDEYVDMGHDGDENEESHKDNHKHNEDGAEESHKDSHRHNEDGAEESHKETASVFLH
STTKHQKIEKVHGATSKRSRGKSSLLSGKSGKTSQTDAKRRARSHRFSGVSCEMKLLNSS
QQIQEPLKTQNFAAPSLQYIQMEDKPDGEEQWEPKFAGHQSLQEREDSFLVQEQKIHCGF
VKAPEGLPSTGFDLTEDDANYISKCHIAVISCIFGNSDRLRHPANKMVSSLSRKDVCFVV
FVDEITMQTLSAEGQVPDGAGFVGLWKLVVVRNLPYTDMRRVGKIPKLLPHRLFTSARYS
IWLDSKLRLQLDPLVILEYFLWREGHEYAISNHYDRHCLWEEVAQNKKLNKYNHTVIDQQ
FEFYQSDGLTRFNASDPHKLLPSNVPEGSFIVREHTPMSNLFSCLWFNEVERFTPRDQLS
FAYTYQKLTRMNPDTPFNLHMFKDCERRKITKLFRHRSEEKRNLIQAATTQ

Other information
Ka divergence:0.163395KaKs divergence:0.741047
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2208Length 2 (bp):2136Length divergence:-0.017
MFE 1 (kcal):-634.6MFE 2 (kcal):-642.95MFE divergence0.007