Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G34780-AT4G08930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):APR-like 4
Function (paralog2):APR-like 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.1627971517011
Log2 mRNA fold difference:0.090101342838289
Log2 TE fold difference:0.096931308759617
Sequences
Protein sequence

MEKEILLLLLVIMFLTVADVDAVRVPFCATKSAKDSIFGLRDQTCSVSGVESDERPRFVA
VTEGDERWLQIALDMIHKNKCDYVALLFYASWCPFSRSFRPSFDVISSLYSSIPHFAIKE
SSIKPSTLSKYGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS
VSVPHLGNENNTEPENCPFTWARSPENMLRQETYLALAIVFVLLRLLHLIYPTLVVFMKF
TWRRIAQNMRLESLLEHTVGFLSRAVQLCMHRRSNLQGGAMNARAWASKSLATVSIGDSS
SSNRRSSSSQ

MEKKLTLLLLVVVVLFVNLTNATVRVQICPRESAKDYILGFRDKSALHRPGFVTEGDDRW
LQMAADMVDKKNKCDYAALLFYASWCPFSRLVRPSFDLMSLLYSSVPHFAIEESSVKAST
LSKYGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTGIETMDERWVERNRLVPHFH
AEPENCPFPWARRSPENLLRQETYLTLATVFVLLRLLHLISPTMVVFVKFTWGRVSNMRL
GNPLEHTVTMYLKEPCMSSNLQEGAMNARAWASKSLATVSIAESSSSSRSVSASQ

www.000webhost.com

Other information
Ka divergence:0.528426KaKs divergence:0.173885
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):933Length 2 (bp):888Length divergence:-0.025
MFE 1 (kcal):-283.54MFE 2 (kcal):-264.26MFE divergence-0.035