Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G35170-AT1G35180
Species:Arabidopsis
Duplication type:TD
Function (paralog1):TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein
Function (paralog2):TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.2300709328944
Log2 mRNA fold difference:1.1296749680759
Log2 TE fold difference:0.12342102696263
Sequences
Protein sequence

MEEEYIRIISITTIRIISWGLIFILVRRIFSSYSFDFSTRIVSTLHATIAVTLATLSIQD
WSCPVCPIASTSSLRQMETLAFSLSYMIYDLICSHFDQVLSIDNAVHHSVCILGFVAGLF
YQKCGSEMVAAIWITEISSPFLHLREILKEIGCRDTDLNLAADVFFATIFSVARMVGGPY
LVYVTIPADNPILIKVMGLGLQLVSAFYKLLKMMRYKFIKRSMSTKKST

MEEEYVRVISITTIGVISWGLIFILVRRIFSSYSFDFSTRIVSTLHATIAVTLATLSIQD
WSCPVCPIASTSSLRQMETLAFSLSYMIYDLICSHFDQVLSIDNAVHHSVCILGFVAGLF
YQKCGSEMVAALWITEISSPFLHLREILKEIGYRDTDLNLAADVCFATIFSLARMVGGPY
LVYVTISADNPILIKAMALGLQLVSAFWFYKILKMMRYKFIKRSMSNKKSA

Other information
Ka divergence:-0.885522KaKs divergence:-0.488393
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):690Length 2 (bp):696Length divergence:0.004
MFE 1 (kcal):-183.5MFE 2 (kcal):-176.36MFE divergence-0.02