Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G35460-AT4G09180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.69363087749683
Log2 mRNA fold difference:-1.1739386439244
Log2 TE fold difference:0.50075254931486
Sequences
Protein sequence

MQSTHISGGSSGGGGGGGGEVSRSGLSRIRSAPATWIETLLEEDEEEGLKPNLCLTELLT
GNNNSGGVITSRDDSFEFLSSVEQGLYNHHQGGGFHRQNSSPADFLSGSGSGTDGYFSNF
GIPANYDYLSTNVDISPTKRSRDMETQFSSQLKEEQMSGGISGMMDMNMDKIFEDSVPCR
VRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEYVKALQSQ
IQELTEQQKRCKCKPKEEQ

MQPTSVGSSGGGDDGGGRGGGGGLSRSGLSRIRSAPATWLEALLEEDEEESLKPNLGLTD
LLTGNSNDLPTSRGSFEFPIPVEQGLYQQGGFHRQNSTPADFLSGSDGFIQSFGIQANYD
YLSGNIDVSPGSKRSREMEALFSSPEFTSQMKGEQSSGQVPTGVSSMSDMNMENLMEDSV
AFRVRAKRGCATHPRSIAERVRRTRISDRIRKLQELVPNMDKQTNTADMLEEAVEYVKVL
QRQIQELTEEQKRCTCIPKEEQ

Other information
Ka divergence:0.0603702KaKs divergence:0.14568
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):780Length 2 (bp):789Length divergence:0.006
MFE 1 (kcal):-243.4MFE 2 (kcal):-253.99MFE divergence0.021