Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G35470-AT4G09340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SPla/RYanodine receptor (SPRY) domain-containing protein
Function (paralog2):SPla/RYanodine receptor (SPRY) domain-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.16953259152805
Log2 mRNA fold difference:0.21358031238818
Log2 TE fold difference:-0.26037601250685
Sequences
Protein sequence

MNSSPPPANSANGDTTNNGENGQDLNLNFLDKIRLSAKRDAKEDEGEELPTELNTINSAG
GFLVVSPDKLSVKYTNTNLHGHDVGVVQANKPAPIKCLTYYFEIFVKDSGIKGQIAIGFT
KESFKMRRQPGWEVNSCGYHGDDGYLYRGQGKGEPFGPKFTKDDAVGGGINYASQEFFFT
KNGTIVGKIPKDIRGHLFPTVAVHSQNEEVLVNFGKKKFAFDIKGYEASERNKQQLAIEK
ISIPPNIGYGLVKTYLLHYGYEETLDAFNLATKNTVPPIHIDQENAIDEDDSSYALKQRK
NLRQLVRNGEIDTALAELQKLYPQIVQDDKSVVCFLLHCQKFIELVRVGKLEEGVNYGRL
ELAKFVGLTGFQDIVEDCFALLAYEKPEESSVWYFLEDSQRELVADAVNAAILSTNPNKK
DVQRSCHLQSHLEKLLRQLTVCCLERRSLNGDQGETFRLRHVLNNNR

MNKSNFIHKFHHSAKPHTMEDNEEEEESPTELNTITGLSGFVVISPDKLSLKYTGVSQHG
HDVGVVQANKPAPCKRFAYYFEIYVKDAGVKGRVSIGFTTNSFRIARHPGWELNTCGYHG
EDGLIYLGKRQGEAFGPTYTTGDTVGGGINYDSQEFFFTVNGTLVGTVSKYIKGPLFPTV
AVHSQNEEVTVNFGQEKFAFDFKGYESSERNKQQIAIEKISIPSNMSLGLVKNYLLHYGY
EETHHALDLATNSTLPPINGAQENGIDDTSYALHERKILRQLIRKGEIDAALAKLRDSYP
QLVQNDKSEVCFLLHCQKFIELVRIGALEEAVKYGRMELAKFIGLTTFQDILEDCFALLV
YERPEESNVGYFLEETQREVVADTVNAAILSTKPKGKNQSHSHLETLLRQLTACCLELRS
LNDGQGEAFSLNRLLRTNNWKRTKKTT

Other information
Ka divergence:0.219724KaKs divergence:-0.0300231
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1404Length 2 (bp):1344Length divergence:-0.022
MFE 1 (kcal):-381.65MFE 2 (kcal):-355.42MFE divergence-0.036