Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G35515-AT4G09460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):high response to osmotic stress 10
Function (paralog2):myb domain protein 6

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.65532762258235
Log2 mRNA fold difference:1.0639913278477
Log2 TE fold difference:-1.6131230465442
Sequences
Protein sequence

MGRSPCCEKAHMNKGAWTKEEDQRLIDYIRNHGEGSWRSLPKSVGLLRCGKSCRLRWINY
LRPDLKRGNFTDGEEQIIVKLHSLFGNKWSLIAGKLPGRTDNEIKNYWNTHIKRKLLNRG
IDPKTHGSIIEPKTTSFHPRNEDLKSTFPGSVKLKMETSCENCASTSGTTTDEDLRLSVD
CDYRYDHLDKELNLDLTLGYSPTRFVGVGSCY

MGRSPCCEKAHTNKGAWTKEEDQRLVDYIRNHGEGCWRSLPKSAGLLRCGKSCRLRWINY
LRPDLKRGNFTDDEDQIIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSHG
IDPQTHRQINESKTVSSQVVVPIQNDAVEYSFSNLAVKPKTENSSDNGASTSGTTTDEDL
RQNGECYYSDNSGHIKLNLDLTLGFGSWSGRIVGVGSSADSKPWCDPVMEARLSLL

Other information
Ka divergence:-0.506816KaKs divergence:-0.402908
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):639Length 2 (bp):711Length divergence:0.053
MFE 1 (kcal):-186MFE 2 (kcal):-208.45MFE divergence0.057