Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G35580-AT4G09510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cytosolic invertase 1
Function (paralog2):cytosolic invertase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.1458242422099
Log2 mRNA fold difference:-1.2810344716192
Log2 TE fold difference:-0.81657048523353
Sequences
Protein sequence

MEGVGLRAVGSHCSLSEMDDLDLTRALDKPRLKIERKRSFDERSMSELSTGYSRHDGIHD
SPRGRSVLDTPLSSARNSFEPHPMMAEAWEALRRSMVFFRGQPVGTLAAVDNTTDEVLNY
DQVFVRDFVPSALAFLMNGEPDIVKHFLLKTLQLQGWEKRVDRFKLGEGVMPASFKVLHD
PIRETDNIVADFGESAIGRVAPVDSGFWWIILLRAYTKSTGDLTLSETPECQKGMKLILS
LCLAEGFDTFPTLLCADGCSMIDRRMGVYGYPIEIQALFFMALRSALSMLKPDGDGREVI
ERIVKRLHALSFHMRNYFWLDHQNLNDIYRFKTEEYSHTAVNKFNVMPDSIPEWVFDFMP
LRGGYFVGNVGPAHMDFRWFALGNCVSILSSLATPDQSMAIMDLLEHRWAELVGEMPLKI
CYPCLEGHEWRIVTGCDPKNTRWSYHNGGSWPVLLWQLTAACIKTGRPQIARRAVDLIES
RLHRDCWPEYYDGKLGRYVGKQARKYQTWSIAGYLVAKMLLEDPSHIGMISLEEDKLMKP
VIKRSASWPQL

MEEGHKEPLVLRVEGSHCSLSEMDDFDLTRALEKPRQLKIERKRSFDERSMSELSTGYVR
QDSILEMAHSPGSRSMVDTPLSVRNSFEPHPMVAEAWEALRRSMVFFRGQPVGTIAAYDH
ASEEVLNYDQVFVRDFVPSALAFLMNGEPDIVKNFLLKTLQLQGWEKRVDRFKLGEGVMP
ASFKVLHDPVRKTDTIIADFGESAIGRVAPVDSGFWWIILLRAYTKSTGDLTLSETPECQ
RGMRLILSLCLSEGFDTFPTLLCADGCSMVDRRMGVYGYPIEIQALFFMALRCALSMLKP
DEEGRDFIERIVKRLHALSFHMRSYFWLDFQQLNDIYRYKTEEYSHTAVNKFNVMPDSIP
DWVFDFMPLRGGYFVGNVSPARMDFRWFSLGNCVSILSSLATPDQSMAIMDLLEHRWEEL
VGEMPLKICYPCIESHEWRIVTGCDPKNTRWSYHNGGSWPVLLWTLTAACIKTGRPQIAR
RAIDLIESRLHRDCWPEYYDGKQGRYVGKQARKYQTWSIAGYLVAKMMLEDPSHIGMISL
EEDKQMKPVIKRSASWTC

www.000webhost.com

Other information
Ka divergence:-0.3964KaKs divergence:-0.0778894
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1656Length 2 (bp):1677Length divergence:0.006
MFE 1 (kcal):-568.4MFE 2 (kcal):-535.57MFE divergence-0.03