Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G35670-AT4G09570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calcium-dependent protein kinase 2
Function (paralog2):calcium-dependent protein kinase 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.6204483055305
Log2 mRNA fold difference:-1.7222165765461
Log2 TE fold difference:0.021188838985331
Sequences
Protein sequence

METKPNPRRPSNTVLPYQTPRLRDHYLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKR
KLVCREDYEDVWREIQIMHHLSEHPNVVRIKGTYEDSVFVHIVMEVCEGGELFDRIVSKG
HFSEREAVKLIKTILGVVEACHSLGVMHRDLKPENFLFDSPKDDAKLKATDFGLSVFYKP
GQYLYDVVGSPYYVAPEVLKKCYGPEIDVWSAGVILYILLSGVPPFWAETESGIFRQILQ
GKLDFKSDPWPTISEAAKDLIYKMLERSPKKRISAHEALCHPWIVDEQAAPDKPLDPAVL
SRLKQFSQMNKIKKMALRVIAERLSEEEIGGLKELFKMIDTDNSGTITFEELKAGLKRVG
SELMESEIKSLMDAADIDNSGTIDYGEFLAATLHMNKMEREENLVAAFSYFDKDGSGYIT
IDELQSACTEFGLCDTPLDDMIKEIDLDNDGKIDFSEFTAMMRKGDGVGRSRTMMKNLNF
NIADAFGVDGEKSDD

MEKPNPRRPSNSVLPYETPRLRDHYLLGKKLGQGQFGTTYLCTEKSSSANYACKSIPKRK
LVCREDYEDVWREIQIMHHLSEHPNVVRIKGTYEDSVFVHIVMEVCEGGELFDRIVSKGC
FSEREAAKLIKTILGVVEACHSLGVMHRDLKPENFLFDSPSDDAKLKATDFGLSVFYKPG
QYLYDVVGSPYYVAPEVLKKCYGPEIDVWSAGVILYILLSGVPPFWAETESGIFRQILQG
KIDFKSDPWPTISEGAKDLIYKMLDRSPKKRISAHEALCHPWIVDEHAAPDKPLDPAVLS
RLKQFSQMNKIKKMALRVIAERLSEEEIGGLKELFKMIDTDNSGTITFEELKAGLKRVGS
ELMESEIKSLMDAADIDNSGTIDYGEFLAATLHINKMEREENLVVAFSYFDKDGSGYITI
DELQQACTEFGLCDTPLDDMIKEIDLDNDGKIDFSEFTAMMKKGDGVGRSRTMRNNLNFN
IAEAFGVEDTSSTAKSDDSPK

Other information
Ka divergence:-0.0446719KaKs divergence:0.999929
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):1488Length 2 (bp):1506Length divergence:0.006
MFE 1 (kcal):-449.71MFE 2 (kcal):-453.25MFE divergence0.004