Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G36160-AT1G36180
Species:Arabidopsis
Duplication type:TD
Function (paralog1):acetyl-CoA carboxylase 1
Function (paralog2):acetyl-CoA carboxylase 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-3.6643958669336
Log2 mRNA fold difference:-4.2035056015215
Log2 TE fold difference:0.54791545237264
Sequences
Protein sequence

MAGSVNGNHSAVGPGINYETVSQVDEFCKALRGKRPIHSILIANNGMAAVKFIRSVRTWA
YETFGTEKAILLVGMATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLIVEMAEVTR
VDAVWPGWGHASENPELPDALDAKGIIFLGPPASSMAALGDKIGSSLIAQAADVPTLPWS
GSHVKIPPNSNLVTIPEEIYRQACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRKVHN
DDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVSALHSRDCSVQRRHQK
IIEEGPITVAPPETVKKLEQAARRLAKSVNYVGAATVEYLYSMDTGEYYFLELNPRLQVE
HPVTEWIAEINLPAAQVAVGMGIPLWQIPEIRRFYGIEHGGGYDSWRKTSVVAFPFDFDK
AQSIRPKGHCVAVRVTSEDPDDGFKPTSGRVQELSFKSKPNVWAYFSVKSGGGIHEFSDS
QFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYTIDLLHASDYRDNKIHTGWLDS
RIAMRVRAERPPWYLSVVGGALYKASATSAAVVSDYVGYLEKGQIPPKHISLVHSQVSLN
IEGSKYTIDVVRGGSGTYRLRMNKSEVVAEIHTLRDGGLLMQLDGKSHVIYAEEEAAGTR
LLIDGRTCLLQNDHDPSKLMAETPCKLMRYLISDNSNIDADTPYAEVEVMKMCMPLLSPA
SGVIHFKMSEGQAMQAGELIANLDLDDPSAVRKAEPFHGSFPRLGLPTAISGRVHQRCAA
TLNAARMILAGYEHKVDEVVQDLLNCLDSPELPFLQWQECFAVLATRLPKNLRNMLESKY
REFESISRNSLTTDFPAKLLKGILEAHLSSCDEKERGALERLIEPLMSLAKSYEGGRESH
ARVIVHSLFEEYLSVEELFNDNMLADVIERMRQLYKKDLLKIVDIVLSHQGIKNKNKLVL
RLMEQLVYPNPAAYRDKLIRFSTLNHTNYSELALKASQLLEQTKLSELRSNIARSLSELE
MFTEDGENMDTPKRKSAINERIEDLVSASLAVEDALVGLFDHSDHTLQRRVVETYIRRLY
QPYVVKDSVRMQWHRSGLLASWEFLEEHMERKNIGLDDPDTSEKGLVEKRSKRKWGAMVI
IKSLQFLPSIISAALRETKHNDYETAGAPLSGNMMHIAIVGINNQMSLLQDSGDEDQAQE
RVNKLAKILKEEEVSSSLCSAGVGVISCIIQRDEGRTPMRHSFHWSLEKQYYVEEPLLRH
LEPPLSIYLELDKLKGYSNIQYTPSRDRQWHLYTVTDKPVPIKRMFLRSLVRQATMNDGF
ILQQGQDKQLSQTLISMAFTSKCVLRSLMDAMEELELNAHNAAMKPDHAHMFLCILREQQ
IDDLVPFPRRVEVNAEDEETTVEMILEEAAREIHRSVGVRMHRLGVCEWEVRLWLVSSGL
ACGAWRVVVANVTGRTCTVHIYREVETPGRNSLIYHSITKKGPLHETPISDQYKPLGYLD
RQRLAARRSNTTYCYDFPLAFGTALELLWASQHPGVKKPYKDTLINVKELVFSKPEGSSG
TSLDLVERPPGLNDFGMVAWCLDMSTPEFPMGRKLLVIANDVTFKAGSFGPREDAFFLAV
TELACAKKLPLIYLAANSGARLGVAEEVKACFKVGWSDEISPENGFQYIYLSPEDHERIG
SSVIAHEVKLSSGETRWVIDTIVGKEDGIGVENLTGSGAIAGAYSKAYNETFTLTFVSGR
TVGIGAYLARLGMRCIQRLDQPIILTGFSTLNKLLGREVYSSHMQLGGPKIMGTNGVVHL
TVSDDLEGVSAILNWLSYIPAYVGGPLPVLAPLDPPERIVEYVPENSCDPRAAIAGVKDN
TGKWLGGIFDKNSFIETLEGWARTVVTGRAKLGGIPVGVVAVETQTVMQIIPADPGQLDS
HERVVPQAGQVWFPDSAAKTAQALMDFNREELPLFILANWRGFSGGQRDLFEGILQAGST
IVENLRTYRQPVFVYIPMMGELRGGAWVVVDSQINSDYVEMYADETARGNVLEPEGTIEI
KFRTKELLECMGRLDQKLISLKAKLQDAKQSEAYANIELLQQQIKAREKQLLPVYIQIAT
KFAELHDTSMRMAAKGVIKSVVEWSGSRSFFYKKLNRRIAESSLVKNVREASGDNLAYKS
SMRLIQDWFCNSDIAKGKEEAWTDDQVFFTWKDNVSNYELKLSELRAQKLLNQLAEIGNS
SDLQALPQGLANLLNKVEPSKREELVAAIRKVLG

MEMRALGSSCSTGNGGSAPITLTNISPWITTVFPSTVKLRSSLRTFKGVSSRVRTFKGVS
STRVLSRTKQQFPLFCFLNPDPISFLENDVSEAERTVVLPDGSVNGAGSVNGYHSDVVPG
RNVAEVNEFCKALGGKRPIHSILVATNGMAAVKFIRSVRTWAYETFGSEKAVKLVAMATP
EDMRINAEHIRIADQFVEVPGGTNNNNYANVQLIVEMAEVTRVDAVWPGWGHASENPELP
DALKEKGIIFLGPPADSMIALGDKIGSSLIAQAADVPTLPWSGSHVKIPPGRSLVTVPEE
IYKKACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRKVHNDDEVRALFKQVQGEVPGS
PIFIMKVASQSRHLEAQLLCDQYGNVAALHSRDCSVQRRHQKIIEEGPITVAPQETIKKL
EQAARRLAKSVNYVGAATVEYLYSMDTGEYYFLELNPRLQVEHPVTEWIAEVNLPAAQVA
VGMGIPLWQIPEIRRFYGMEHGGGYDSWRKTSVVASPFDFDEAESLRPKGHCVAVRVTSE
DPDDGFKPTSGEIQELSFKSKPNMWSYFSVKSGGGIHEFSDSQFGHVFAFGESRSVAIAN
MVLALKEIQIRGDIRTNVDYTIDLLHASDYRENKIHTGWLDSRIAMRVRAERPPWYLSVV
GGALYKASTTSSAVVSDYVGYLEKGQIPPKHISLVHSQVSLNIEGSKYTIDVVRGGSGTY
RLRMSNSEVVAEIHTLRDGGLLMQLDGKSHVIYAKEEATGTRLLIDGRTCLLQNDHDPSK
LMAETPCKLLRYLVSDNSSIDTDTPYAEVEVMKMCMPLISPASGVIHFKLSEGQAMQAGE
LIAKLDLDDPSAVRKAKPFRGSFPRLGLPTAISGKVHQRCAATLNAARMILAGYDHKVDE
VLQDLLNCLDSPELPFLQWQECFAVLATRLPKDLRNMLELKYKEFEIISKTSLTPDFPAK
LLKGILEAHLSSCDEKERGSLERLIEPLMSLVKSYEGGRESHARLIVHSLFEEYLSVEEL
FNDNMLADVIERMRQQYKKDRLKIVDIVLSHQGIIHKNKLVLRLMEQLVYPNPAAYREKL
IRFSALNHTNYSQLALKASQLLEQTKRSELRSNIARSLSELEMFTEAGENMDTPKRKSAI
SETMENLVSSSLAVEDALVGLFDHSDHTLQRRVVETYIHRLYQPYVVKESVRMQWHQSGV
IASWEFLEHFERKNTGPDDHEISEKGIVAKSSKRKRGTMVIIKSLQFLPSIINASLRETN
HSHCEYARAPLSGNMMHIAVVGINNQMSLLQDSGDEDQTQERVNKLAKILKEEEVSLTLC
SAGVGVISCIIQRDEGRTPMRHSFHWLMEKQYYVEEPLLRHVEPPLSVYLELDKLKGYSN
IQYSPSRDRQWHMYSVTDRPVPIKRMFLRSLVRQTTMNDGFLLQQGQDYQLSQTVLSMAF
TSKCILRSLMNAMEELELNAHNAAMKPDHAHMFLCILREQQIDDLVPYPRRFEVNAEDEE
TTVETILEEATQEIHRSVGVRMHALGVCEWEVRLWLVSSGLANGAWRVVVANVTGRTCTV
HIYREVEATGRNSLIYHSITKKGPLHGTLINGQYKPLNNLDRKRLAARRSNTTYCYDFPL
AFETALELNWASQHSGVRKPCKNRLINVKELVFSNTEGSLGTSLIPVERPAGLNDIGMVA
WILEMSTPEFPMGRKLLIVANDVTFKAGSFGPREDAFFLAVTELACTKKLPLIYLAANSG
ARLGVAEEVKACFKVGWSDEVSPGNDFQYIYLSSEDYARIGSSVIAHEVKLPSGETRWVI
DTIVGKEDGLGVENLTGSGAIAGAYSRAYNETFTLTFVSGRSVGIGAYLARLGMRCIQRL
DQPIILTGFSTLNKLLGREVYSSHMQLGGPKIMGTNGVVHLTVSDDLEGVSAILNWLSYI
PAYVGGPLPVLAPLDPPERTVEYIPENSCDPRAAIAGINDNTGKWLGGIFDKNSFVETLE
GWARTVVTGRAKLGGIPIGVVAVETQTVMHVIPADPGQLDSHERVVPQAGQVWFPDSAAK
TAQALMDFNREQLPLFIIANWRGFSGGQRDLFEGILQAGSAIVENLRTYRQPVFVYIPMM
GELRGGAWVVVDSQINSDYIEMYADETARGNVLEPEGMIEIKFRRKELLECMGRLDQTLI
NLKANIQDAKRNKAYANIELLQKQIKTREKQLLPVYTQIATKFAELHDTSMRMAAKGVIK
SVVEWSGSRSFFYKKLYRRIAESSLVRNIRKASGDILSYKSAMGLIQDWFRKSEIAKGKE
EAWTDDQLFFTWKDNVSNYEQKLSELRTQKLLNQLAEIGNSSDLQALPQGLANLLNKVDL
SRREELVDAIRKVLG

www.000webhost.com

Other information
Ka divergence:0.242684KaKs divergence:0.288285
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):6765Length 2 (bp):7068Length divergence:0.022
MFE 1 (kcal):-2196.44MFE 2 (kcal):-2234.74MFE divergence0.009