Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G47490-AT1G47500
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RNA-binding protein 47C
Function (paralog2):RNA-binding protein 47C'

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.15946859385613
Log2 mRNA fold difference:-0.087992134798012
Log2 TE fold difference:-0.059241341664434
Sequences
Protein sequence

MADVKIQSESESSDSHPVVDNQPPPPPPPPQQPAKEEENQPKTSPTPPPHWMRYPPTVII
PHQMMYAPPPFPPYHQYPNHHHLHHQSRGNKHQNAFNGENKTIWVGDLHHWMDEAYLNSS
FASGDEREIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNW
ASFSTGEKRLENNGPDLSIFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKG
YGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKTNGYQQQGGYMPNGTLTRPEGD
IMNTTIFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLN
GTVIGKQTVRLSWGRNPANKQPRDKYGNQWVDPYYGGQFYNGYGYMVPQPDPRMYPAAPY
YPMYGGHQQQVS

MADVKVQSESESSDSHPLVDYQSLPPYPPPHPPVEVEENQPKTSPTPPPPHWMRYPPVLM
PQMMYAPPPPMPFSPYHQYPNHHHFHHQSRGNKHQNAFNGENKTIWVGDLQNWMDEAYLN
SAFTSAEEREIVSLKVIRNKHNGSSEGYGFVEFESHDVADKVLQEFNGAPMPNTDQPFRL
NWASFSTGEKRLENNGPDLSIFVGDLAPDVSDALLHETFSEKYPSVKAAKVVLDANTGRS
KGYGFVRFGDENERTKAMTEMNGVKCSSRAMRIGPATPRKTNGYQQQGGYMPSGAFTRSE
GDTINTTIFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEK
LNGTVIGKQTVRLSWGRNPANKQPRDKYGNQWVDPYYGGQFYNGYGYMVPQPDPRMYPAA
PYYPMYGGHQQQVS

www.000webhost.com

Other information
Ka divergence:0.252502KaKs divergence:-0.136294
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1299Length 2 (bp):1305Length divergence:0.002
MFE 1 (kcal):-402.84MFE 2 (kcal):-400.37MFE divergence-0.003