Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G47550-AT1G47560
Species:Arabidopsis
Duplication type:TD
Function (paralog1):exocyst complex component sec3A
Function (paralog2):exocyst complex component sec3B

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.7787958162102
Log2 mRNA fold difference:-1.3881462705121
Log2 TE fold difference:-0.41059917841815
Sequences
Protein sequence

MAKSSADDEELRRACEAAIEGTKQSIVMSIRVAKSRGVWGKSGKLGRQMAKPRVLALSVK
SKGPRKKAFLRVMKYSSGGVLEPAKMYKLKHLSKVEVITNDPSGCTFTLGFDNLRSQSVA
PPQWTMRNTDDRNRLLVCILNICKDVLGRLPKVVGIDIVEMALWAKDNTPVVTTQRSTED
GEPVAESVTESDLKVTVEKELVSQAEEEDMEALLGTYVMGIGEAEAFSERLKRELQALEA
ANVHAILESEPLVDEVLNGLEAATNIVDDMDEWLGIFNIKLRHMREDIESIETRNNKLEM
QSVNNKALIEELDKVIERLRVPSEYAASLTGGSFDEADMLQNIEACEWLAKALRGLEVPN
LDPIYANMRAVKEKRAELEKLKATFVRRASEFLRNYFASLVDFMVSDKSYFSQRGQLKRP
DHADLRYKCRTYARLLQHLKGLDKNCLGPLRKAYCSSLNLLLRREAREFANELRASTKVS
RNPTVWLEGSTGSSQNANTDTSAVSDAYAKMLTIFIPLLVDESSFFAHFMCFEVPALAPP
GGAGNDKKSQSNNDDGNDDDDLGIMDIDETDKKPGKNSPDLTALNESLQDLLDGIQEDFY
AVVDWAYKIDPLRCISMHGITERYLSGQKADAAGFVRLLLGDLESRVSMQFSRVFVDEAC
HQIERNERNVRQMGVLPYIPRFAALATRMEQYIQGQSRDLVDQAYTKFVSIMFVTLEKIA
QQDPKYADILLLENYAAFQNSLYDLANVVPTLAKFYHQASEAYEQACTRHISMIIYYQFE
RLFQFAKKIEDFMYTITPEEIPFQLGLSKVELRKMLKSSLSGVDKSIAAMYKKLQKNLAS
EELLPSLWDKCKKEFLDKYESFVQLVAKVYPSENVPGVTEMRGLLASM

MAKSSADDEELRRACEAAIEGTKQSIVMSIRVAKSRGVWGKSGKLGRQMAKPRVLALSVK
SKGPRKKAILRVMKYSSGGVLEPAKMYDLKHLSKVEVITSDPSGCTFTLGFDNLRSQSVA
PPQWTMRNTDDRNRLLVCILNICKDVLGRLPKVVGIDIVEMALWAKDNTPVVTTQRSTED
GEPVAESVTESALKVTVEKELVSQAEEEDMEALLGTYVIGIGEAEAFSERLKRELQALEA
ANVHAILESEPLVDEVLNGLEAATNIVDDMDEWLGIFNIKLRHMREDIESIEIRNNKLEM
QSVNNKALIEELDKVIERLRVPSEYAASLTGGSFDEADMLQNIEACEWLAKALRGLEVPN
LDPIYANMRAVKEKRAELEKLKATFVRRASEFLRDYFASLVDFKFSDKSYFSQRGQLKRP
DHADLRYKCRTYARLMQHLKGLNKNCLGPLRKAYCSSLNLLLRREAREFAKELRASTKVS
RNPTVWLEGSTGSSQNANTDTSAVSDAYAKMLTIFIPLLVDESSFFAHFMCFEVPALAPP
GGAGNDKKSQSNNDDGNDNDDLGIMDIDEADKKPGKNSPDLTALNESLQDLLDGIQEDFY
AVVDWAYKIDPLRSISMHGITERYLSGQKADAAGFVRLLLGDLESRISMQFSHFVDEACH
QIEKNERNVRQMGVLPYIPRFAALATRMEQYIQGQSRNLVDQAYTKFVSILFVTLEKIAQ
QDPKYADILLLENYAAFQTCLFDLANVVPTLAKFYDQAMEAYEQACTRHISMIIYYQFER
LFLFDKKIKDLMYTITPEEIPFQLGLSKVELRKMLKSSLSGVDKSIAAMYKKLQKNLASE
ELLPSLWDKCKKEFLDKYESFVQLVAKVYPSENVPGVTEMRGLLASM

www.000webhost.com

Other information
Ka divergence:0.923137KaKs divergence:0.999986
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2667Length 2 (bp):2664Length divergence:-0.001
MFE 1 (kcal):-801.55MFE 2 (kcal):-809.78MFE divergence0.005