Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G47960-AT3G17140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cell wall / vacuolar inhibitor of fructosidase 1
Function (paralog2):Plant invertase/pectin methylesterase inhibitor superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.915175012284
Log2 mRNA fold difference:-3.599697148777
Log2 TE fold difference:1.7882994695806
Sequences
Protein sequence

MKMMKVMMLIVMMMMVMVMVSEGSIIEPTCKETPDFNLCVSLLNSDPRGSSADTSGLALI
LIDKIKGLATKTLNEINGLYKKRPELKRALDECSRRYKTILNADVPEAIEAISKGVPKFG
EDGVIDAGVEASVCQGGFNGSSPLTSLTKSMQKISNVTRAIFYSNSIVKEEACGSSWPSL
ALNIDSKACVVSLQNIQFNRGRTCW

MAMVVGVAMGNIALGAETVGQINEAYKTKPMLKKPLDECSMRYKTIVDVDVHTAIISIKG
NPKFAEGAVVDAGVEASICEGGFTKGQSPLTSLTQRMEKICDVTRAIIRMLL

Other information
Ka divergence:0.0918645KaKs divergence:0.112084
GC content 1 (%):42GC content 2 (%):48GC content divergence:0.067
Length 1 (bp):618Length 2 (bp):339Length divergence:-0.292
MFE 1 (kcal):-174.29MFE 2 (kcal):-101.14MFE divergence-0.266