Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48030-AT3G17240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mitochondrial lipoamide dehydrogenase 1
Function (paralog2):lipoamide dehydrogenase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.2320267093248
Log2 mRNA fold difference:-1.3633573587031
Log2 TE fold difference:0.12145947326069
Sequences
Protein sequence

MAMASLARRKAYFLTRNLSNSPTDALRFSFSLSRGFASSGSDENDVVIIGGGPGGYVAAI
KASQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHSFANHGIKVSSVEVD
LPAMLAQKDNAVKNLTRGIEGLFKKNKVTYVKGYGKFISPNEVSVETIDGGNTIVKGKHI
IVATGSDVKSLPGITIDEKKIVSSTGALSLSEVPKKLIVIGAGYIGLEMGSVWGRLGSEV
TVVEFAGDIVPSMDGEIRKQFQRSLEKQKMKFMLKTKVVSVDSSSDGVKLTVEPAEGGEQ
SILEADVVLVSAGRTPFTSGLDLEKIGVETDKAGRILVNDRFLSNVPGVYAIGDVIPGPM
LAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTHPEVASVGKTEEQLKKEGVSYRVGKF
PFMANSRAKAIDNAEGLVKILADKETDKILGVHIMAPNAGELIHEAVLAINYDASSEDIA
RVCHAHPTMSEALKEAAMATYDKPIHI

MAMASLARRKAYFLTRNISNSPTDAFRFSFSLTRGFASSGSDDNDVVIIGGGPGGYVAAI
KAAQLGLKTTCIEKRGALGGTCLNVGCIPSKALLHSSHMYHEAKHVFANHGVKVSSVEVD
LPAMLAQKDTAVKNLTRGVEGLFKKNKVNYVKGYGKFLSPSEVSVDTIDGENVVVKGKHI
IVATGSDVKSLPGITIDEKKIVSSTGALSLTEIPKKLIVIGAGYIGLEMGSVWGRLGSEV
TVVEFAADIVPAMDGEIRKQFQRSLEKQKMKFMLKTKVVGVDSSGDGVKLIVEPAEGGEQ
TTLEADVVLVSAGRTPFTSGLDLEKIGVETDKGGRILVNERFSTNVSGVYAIGDVIPGPM
LAHKAEEDGVACVEFIAGKHGHVDYDKVPGVVYTYPEVASVGKTEEQLKKEGVSYNVGKF
PFMANSRAKAIDTAEGMVKILADKETDKILGVHIMSPNAGELIHEAVLAINYDASSEDIA
RVCHAHPTMSEAIKEAAMATYDKPIHM

Other information
Ka divergence:0.0101986KaKs divergence:-0.207898
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1524Length 2 (bp):1524Length divergence:0
MFE 1 (kcal):-505.9MFE 2 (kcal):-505.23MFE divergence-0.001