Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48040-AT3G17250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein phosphatase 2C family protein
Function (paralog2):Protein phosphatase 2C family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.49930474000431
Log2 mRNA fold difference:-0.49653764876781
Log2 TE fold difference:0.064160584839836
Sequences
Protein sequence

MILSQTMVAEAEIRVLDVKCHISAPKDQKNFQIDEVRVSESVRAEISGSAETPRFGSGMS
CVTTTIGESASDFIPTIRSGSFADIRSRETMEDEHICIDDLSAHLGSYNFSVPSAFYGVF
DGHGGPEAAIFMKENLTRLFFQDAVFPEMPSIVDAFFLEELENSHRKAFALADLAMADET
IVSGSCGTTALTALIIGRHLLVANAGDCRAVLCRRGVAVDMSFDHRSTYEPERRRIEDLG
GYFEDGYLNGVLAVTRAIGDWELKNPFTDSSSPLISDPEIGQIILTEDDEFLILACDGIW
DVLSSQNAVSNVRQGLRRHGDPRQCAMELGKEAARLQSSDNMTVIVICFSSVPSSPKQPQ
RRRLRFCVSDEARARLQAMLAGE

MRTSKASVTQTWLLYTQLCLWKDLIIRYVRQIIRRAKSMLFSQNMVADSAEISVIDVKSH
LSVAKDPSNFQIAEIRIHDSICIDIPSSEETPLLESIKSCSATTIEEHVTEFVPNISSGS
YADKGDYREYMEDEHICIDDLSDHLGSSFYRFPVPMAFYGVFDGHGGSDASQYIKENAMS
LFFEDAVFRQSPSVVDSLFLKELETSHREAYRLADLAMEDERIVSSSCGTTALTALVIGR
HLMVANVGDCRAVLCRKGKAVDMSFDHKSTFEPERRRVEDLGGYFEGEYLYGDLAVTRAL
GDWSIKRFSPLGESLSPLISDPDIQQMILTEEDEFLIMGCDGVWDVMTSQYAVTFVRQGL
RRHGDPRRCAMELGREALRLDSSDNVTVVVICFSSSPAPQRRRIRFCVSDEARARLQTML
EG

Other information
Ka divergence:0.37932KaKs divergence:0.262666
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1152Length 2 (bp):1269Length divergence:0.048
MFE 1 (kcal):-356.1MFE 2 (kcal):-390.02MFE divergence0.045