Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48110-AT3G17330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):evolutionarily conserved C-terminal region 7
Function (paralog2):evolutionarily conserved C-terminal region 6

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.22296952713178
Log2 mRNA fold difference:-0.67220104666372
Log2 TE fold difference:0.3957533432589
Sequences
Protein sequence

MYTSEAAPDFVVDQGMYYPVDASYGYYCTGYESPGDWENHQMFFGVDGSEVQYTGGQNEN
SPYICYTPSYGYAQSPYNPFNPYIPGASIGVDSAFVAPQQFYSIPPYQSVATSPTFVPYA
IQPEIVSNSSTNSLVETGSANRGRSDGRGSRQRSGTATAGLQRNDPKLPAGNSLGKISEK
PRPNSGQSRQSEMDKSDSTSSSGQARQGRVTSVSAQPVDVVSSSRVSSFRQLDIAPPQLN
DFSKIATNNNNIRPKLYGGHANIIPDTVREQNRGRRSRALGNQLIVKAYTTKAGNADAEG
NIVINPSQYNKEDLRIDYSNAKFFVIKSYSEDDVHKSIKYNVWSSTLHGNKKLQSAYEDA
QRIATEKSCECPIFLFFSVNASGLFCGMAEMTGPVSFDKDMDFWQQDKWSGSFPVKWHII
KDVPNSYFRHIILQNNENKPVTNSRDTQEIMLKQGLEVLKIFKDHMERTSLLDDFVYYES
RQRVMQDERTRLPYRTFLNDLPLPRPDLSDRNKKTPLESFKKPSVISAKTEELPSKSEGN
EETTVKEGNEEDTSSTQKKISSLTIDPSGTDSNPTTVSHLNQKSQAKSKPNSSGSLKKTD
PSEVVDASLSDKNDSFKVTGSPAILTVGTIPLDPKSLQK

MYTEGASDFVIDQSMYYPAYYSSGYDSSVGLQGGQNENAPYICYTPSYGYAQSPYNPYNP
YIPGASIGVDSSFVGFQQYYSDPPYESAASSPTYVPYVIQPDMVSNSSTDSLVANGGQSD
GRGSMQRNGSAIAGLPKDAPKSTTTGQYKQPGIPKNVSTTASAHSLQGKTAYANTLLPYG
KSDIANGVSSIASYSYKPCSKIYDARGDNNTTGSTYTSEQNRGSRTRRSRNQLIVKAYTT
KAGNADAEGNIVINPDRYNKEDFSIEYSDARFFVIKSYSEDDVHKSIKYGVWSSTLNGNK
KLQSVYEDAQRIATEKSRECPIFLFFSVNSSGLFCGVAEMTGPVSFDRDMDFWQQDKWSG
SFPVKWHIIKDVPNSYFRHIILHNNENKPVTNSRDTQEIILKQGLEVLKLFKHHAEKTSL
LDDFMYYEDRQRLMQEERARLPFRTFRRPFPVLNLDFSDRSKKSSKDVVKKPSVTSAETK
VVQLKNSDGDEKSNTQEATDDSTPSTLKFGSLAIKPTAGTTFNPTQPKPKPTPSLGSDHK
SDSSEEVTGSLADDIVSVGSLPIKVKGSKELSSKIAAVGTSPLSTQDQFRSKPGF

Other information
Ka divergence:0.0358603KaKs divergence:-0.0623775
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1920Length 2 (bp):1788Length divergence:-0.036
MFE 1 (kcal):-544.47MFE 2 (kcal):-485.06MFE divergence-0.058