Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48210-AT3G17410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.54094430675972
Log2 mRNA fold difference:0.48419922189098
Log2 TE fold difference:0.041026086515468
Sequences
Protein sequence

MSCFGWCGSEDFRNATDTGPRPAHNPAGYNGGHYQRADPPMNQPVIPMQPISVPAIPVDE
LRDITDNYGSKTLIGEGSYGRVFYGVLKSGGAAAIKKLDSSKQPDQEFLSQISMVSRLRH
DNVTALMGYCVDGPLRVLAYEFAPKGSLHDTLHGKKGAKGALRGPVMTWQQRVKIAVGAA
RGLEYLHEKVSPQVIHRDIKSSNVLLFDDDVAKIGDFDLSDQAPDMAARLHSTRVLGTFG
YHAPEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVK
QCVDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKALQPLLNPPRSAPQTPHR
NPY

MGCFGCCGGGEDFRRVSETGPKPVHNTGGYNGGHHQRADPPKNLPVIQMQPISVAAIPAD
ELRDITDNYGSKSLIGEGSYGRVFYGILKSGKAAAIKKLDSSKQPDQEFLAQVSMVSRLR
QENVVALLGYCVDGPLRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWHQRVKIAVGA
ARGLEYLHEKANPHVIHRDIKSSNVLLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTF
GYHAPEYAMTGTLSTKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSVVTWATPKLSEDKV
KQCVDARLNGEYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNPPRSAPQTPH
RNPY

www.000webhost.com

Other information
Ka divergence:-0.518636KaKs divergence:-0.382906
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1092Length 2 (bp):1095Length divergence:0.001
MFE 1 (kcal):-353.75MFE 2 (kcal):-354MFE divergence0