Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48230-AT3G17430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nodulin MtN21 /EamA-like transporter family protein
Function (paralog2):Nucleotide-sugar transporter family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3027071361607
Log2 mRNA fold difference:-1.3886079176519
Log2 TE fold difference:0.0013507291014799
Sequences
Protein sequence

MAKMINKTLVLTYIYLLIYIILSSGVILYNKWVLSPKYFNFPLPITLTMIHMGFSGFVAF
LLIRVFKVVSPVKMTFEIYVTCVVPISAFFASSLWFGNTAYLHISVAFIQMLKALMPVAT
FLMAVVCGTDKARCDVFMNMVLVSVGVVVSSYGEINFNVIGTVYQVMGIFAEALRLVLTQ
VLLQKKGLTLNPVTSLYYIAPCSFVFLSLPWYVLEKPNIDVSQIQFNFWIFFSNALCALA
LNFSIFLVIGRTGAVTIRVAGVLKDWILIALSTVIFPESTITGLNITGYAIALCGVVMYN
YIKIKDVKAIQPTTDSLPDRITKDWKEKNSSDGGSPRGLELNDEEAPLITSRLSHIGRTQ
LGNHTAV

MAKMINKTLVLTYIYLLIYIILSSGVILYNKWVLSPKYFNFPLPITLTMIHMGFAGFVAF
LLIRVFKVVAPVKMTFEIYATCVVPISAFFASSLWFGNTAYLHISVAFIQMLKALMPVAT
FIMAVVCGTDKPRCDVFSNMLLVSVGVVISSYGEIHFNIVGTVYQVTGIFAEALRLVLTQ
VLLQKKGLTLNPITSLYYIAPCSFVFLALPWYVLEKPTMEVSQIQFNFWIFFSNALCALA
LNFSIFLVIGRTGAVTIRVAGVLKDWILIALSTVIFPESTITGLNITGYAIALCGVVMYN
YIKVRDVKASQPTADSLPDRINKEYKMEKKSSDKFNPNDSVEIPRVGGEVNDEEAPLITS
RLSHIGRTQLGNHAA

www.000webhost.com

Other information
Ka divergence:-0.116924KaKs divergence:-0.0597758
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1104Length 2 (bp):1128Length divergence:0.011
MFE 1 (kcal):-307.43MFE 2 (kcal):-331.91MFE divergence0.038