Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48240-AT3G17440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):novel plant snare 12
Function (paralog2):novel plant snare 13

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.55846791612377
Log2 mRNA fold difference:-0.35270494234771
Log2 TE fold difference:0.89852890364657
Sequences
Protein sequence

MASELPMSPHLEQIHGEIRDHFRALANGFQRLDKIKDSSRQSKQLEELAEKMRDCKRLVK
EFDRELKDGEARNSPQVNKQLNDEKQSMIKELNSYVALRKTYLNTLGNKKVELFDTGAGV
SGEPTAEENVQMASTMSNQELVDAGMKRMDETDQAIERSKQVVHQTLEVGTQTASNLKGQ
TDQMGRVVNDLDTIQFSLKKASQLVKEIGRQVATDKCIMAFLFLIVCGVIAIIIVKIVNP
NNKDIRDIPGLAPPAQSRKLLYFRE

MASNLPMSPQLEQIHGEIRDHFRALANGFQRLDKIKDSTRQSKQLEELTDKMRECKRLVK
EFDRELKDEEARNSPEVNKQLNDEKQSMIKELNSYVALRKTYMSTLGNKKVELFDMGAGV
SGEPTAEENVQVASSMSNQELVDAGMKRMDETDQAIERSKQVVEQTLEVGTQTAANLKGQ
TDQMGRVVNHLDTIQFSIKKASQLVKEIGRQVATDKCIMGFLFLIVCGVVAIIIVKIVNP
NNKDIRDIPGLAPPAQSRKLLYLRNQDYM

www.000webhost.com

Other information
Ka divergence:-0.37049KaKs divergence:-0.376075
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):798Length 2 (bp):810Length divergence:0.007
MFE 1 (kcal):-217.6MFE 2 (kcal):-226.93MFE divergence0.021