Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48260-AT3G17510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CBL-interacting protein kinase 17
Function (paralog2):CBL-interacting protein kinase 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:4.331101738059
Log2 mRNA fold difference:4.8742669816982
Log2 TE fold difference:-0.64752772713587
Sequences
Protein sequence

MVIKGMRVGKYELGRTLGEGNSAKVKFAIDTLTGESFAIKIIEKSCITRLNVSFQIKREI
RTLKVLKHPNIVRLHEVLASKTKIYMVLECVTGGDLFDRIVSKGKLSETQGRKMFQQLID
GVSYCHNKGVFHRDLKLENVLLDAKGHIKITDFGLSALSQHYREDGLLHTTCGSPNYVAP
EVLANEGYDGAASDIWSCGVILYVILTGCLPFDDANLAVICRKIFKGDPPIPRWISLGAK
TMIKRMLDPNPVTRVTIAGIKAHDWFKHDYTPSNYDDDDDVYLIQEDVFMMKEYEEEKSP
DSPTIINAFQLIGMSSFLDLSGFFETEKLSERQIRFTSNSLAKDLLENIETIFTEMGFCL
QKKHAKLKAIKEESTQKRQCGLSVTAEVFEISPSLNVVELRKSHGDSSLYKQLYERLLNE
LGSSSQVQELLA

MVRRQEEEKKAEKGMRLGKYELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLN
FSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDG
RKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTT
CGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPI
PRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKLEYIPSIPDDDDEEEVDTDDDAFS
IQELGSEEGKGSDSPTIINAFQLIGMSSFLDLSGFFEQENVSERRIRFTSNSSAKDLLEK
IETAVTEMGFSVQKKHAKLRVKQEERNQKGQVGLSVTAEVFEIKPSLNVVELRKSYGDSC
LYRQLYERLLKDVGTSSPEQEIVT

Other information
Ka divergence:-0.277225KaKs divergence:-0.05
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1299Length 2 (bp):1335Length divergence:0.014
MFE 1 (kcal):-366.2MFE 2 (kcal):-373.81MFE divergence0.01