Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48330-AT3G17580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.2738932151883
Log2 mRNA fold difference:-2.9911052236597
Log2 TE fold difference:1.2530257979334
Sequences
Protein sequence

MASWKKTIATPFKKAATFFNQPQQTNRHANAKAREEHEKRTVQELQGDVMACGYEDVLVM
WSILDKSNSSNNLSS

MASWKKTIATPFKKAATFFNQPQQSPKKGCRGRMDAQAREEHEKRMVQELQGEVMACGYD
DVLVMWSILDKSNSSNNLSS

www.000webhost.com

Other information
Ka divergence:0.955341KaKs divergence:-0.999887
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):228Length 2 (bp):243Length divergence:0.032
MFE 1 (kcal):-46MFE 2 (kcal):-63.25MFE divergence0.158