Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48370-AT3G17650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):YELLOW STRIPE like 8
Function (paralog2):YELLOW STRIPE like 5

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.6701091862776
Log2 mRNA fold difference:3.5256410085056
Log2 TE fold difference:-0.84944776097794
Sequences
Protein sequence

MRKGGLTPDRDRQIEEHELQETGISPDIERLKRNINATPYQREEEEEDREEQEESVEGIF
ESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWT
KMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSHRIADQSGDVARGVK
DPSLGWMIAFLFVVSFLGLFSVVPLRKIMIIDFKLPYPSGTATAHLINSFHTPQGAKLAK
KQVRVLGKFFSFSFFWGFFQWFFTAGENCGFNSFPTFGLRAYQYKFYFDFSATYVGVGMI
CPYIINISLLLGGILSWGLMWPLIETRKGDWFPSNVDSSSMNGLQAYKVFIAVATILGDG
LYNFCKVLIRTFSGLISQIRGKAGSRSSLAHKEDPPASPASPLTPRISYDDQRRTRFFLK
DQIPSWFAVGGYVVISAVSTAILPHMFSQLRWYYIIVIYIFAPILAFCNAYGAGLTDWSL
ASTYGKLAIFTIGAWAGSDHGGLLAGLAACGVMMNIVSTASDLTQDFKTGYLTLSSPRAM
FVSQVIGTAMGCLVSPCVFWLFYKAFDDLGLPNSEYPAPFATVYRSMAKLGVEGVSSLPR
DCLMLCYVFFGVAILINLIKDCLGNRWGRFVPLPMAMAIPFFLGPYFAIDMCVGSFILFV
WERLDAPKAEAFATAVASGLICGDGIWTLPSSVLAIAGVKPPICMKFLSAATNHRVDKFL
QGSS

MRKGVLNPDRDRQIVEHELQETGFSPETEKVKNKNFEEDEEEEDESVEKIFESREVPSWK
KQLTVRAFVVSFMLSILFSFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKMLHRSGLL
KQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFGMSERIATQSGDVSRGVKDPSLGWIIG
FLFVVSFLGLFSVVPLRKIMVIDFKLTYPSGTATAHLINSFHTPQGAKLAKKQVRVLGKF
FSLSFFWSFFQWFFTGGENCGFSNFPTFGLKAYQYKFYFDFSATYVGVGMICPYIINISV
LLGGILSWGIMWPLIETKKGDWFPDNVPSSSMHGLQAYKVFIAVAIILGDGLYNFCKVLS
RTLSGLFVQLRGPTTSISRTSFTLEEDPHASPLSPKQSYDDQRRTRFFLKDQIPTWFAVG
GYITIAATSTAILPHMFHQLRWYYILVIYICAPVLAFCNAYGAGLTDWSLASTYGKLAIF
TIGAWAGSEHGGMLAGLAACGVMMNIVSTASDLTQDFKTGYLTLSSPKSMFVSQVIGTAM
GCVVSPCVFWLFYKAFDDLGLPNTEYPAPFATVYRSMAKLGVEGVASLPRECLVLCYAFF
GVAILVNIVKDSLHSNWGRFIPLPMAMAIPFFLGPYFAIDMCVGSLILFIWERVDAAKAE
AFGTAVASGLICGDGIWSLPSSVLAIAGVNPPVCMKFLSSATNSKVDNFLKGSI

www.000webhost.com

Other information
Ka divergence:-0.0807507KaKs divergence:0.0286202
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2175Length 2 (bp):2145Length divergence:-0.007
MFE 1 (kcal):-680.96MFE 2 (kcal):-672.46MFE divergence-0.006