Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48430-AT3G17770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Dihydroxyacetone kinase
Function (paralog2):Dihydroxyacetone kinase

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1001895568346
Log2 mRNA fold difference:0.48754710694789
Log2 TE fold difference:0.51824130772587
Sequences
Protein sequence

MVPPAKKFINNPNDVVTEFIEGLVETYPGLQYLDGLPEIKVVLRADVSAANYDKVAVISG
GGSGHEPAQAGYVGEGMLTAAICGDVFASPTVDSILARIRAVTGPKGCLLVVTNYTGDRL
NFGLAAEQAKTEGFDIETVIVGDDCALPPPRGVAGRRGLAGTVLVHKVAGAAAAAGLSLA
EVAAEAKHASEMVGTMGVALSVCALPGQVTSDRLGPEKMELGLGVHGEPGAAVVDIQPVE
VVVSHVLQQILSPETNYVPITRGNSVVLMINGLGGTPLMELMIAAGKAVPKLQLEYGLAV
DRVYTGSFMTSLDMAGFSISIMKADQSILERLDAPTNAPSWPVGTDGSRPPAKIPVPLPF
RSTKNEESRYRPQELSQQGRILEAAIEAAATVVINLKDSLNEWDGKVGDGDCGSTMCRGA
TAILEDMKKYYPLNDAAETVSEIGSSIRRVMGGTSGIIYNLLCKAAYAELKANSQSETTS
KHWSEALKSSISAVSKYGGATAGYRTMLDALIPASKVLEEKLSVGEDPIAAFVLSAEAAT
AGAESTIHMKAQAGRSSYVSAEIFASIPDPGAMAAAAWYSAAARAVKEQRQRF

MDFAAKKFINNPNDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADVSAAKYDKVAVISG
GGSGHEPAHAGYVGEGMLTAAICGDVFASPPVDSILAGIRAVTGTEGCLLIVKNYTGDRL
NFGLAAEQAKSEGYKVETVIVGEDCALPPPRGIAGRRGLAGTVLVHKVAGAAAAAGLSLE
KVAAEAKCASEMVGTMGVALSVCTLPGQVTSDRLGAQKMELGLGIHGEPGAAVVDVEPVD
VVVSHVLQQILSPETNYVPITRGNRVVLMVNGLGGTPLMELMIAAGKAVPKLQLEFGLAV
DRVYTGFFMTSLDMAGFSISIMKADHSILDRLDAPTKAPNWPVGTDGNRPPAKIPVPVPP
SRSIKSMESQSRPLELSKEGQVLEAAIQAAATVIISLKDSLNEWDGKVGDGDCGSTMYRG
ATAILEDMKNYYPLNDAAETVNEIGLSIKRAMGGTSGIIYHLLCKAAYAELKANAQSEVT
PKNWSEALKSSIASVSKYGGATAGYRTMLDALIPASQVLEEKLSAGEDPISAFILSGEAA
TAGAESTIQMQAQAGRSSYVSAENLATVPDPGAMAAAGWYNAAARAVKEQYEGSS

Other information
Ka divergence:-0.0860058KaKs divergence:-0.137341
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1782Length 2 (bp):1788Length divergence:0.002
MFE 1 (kcal):-600.37MFE 2 (kcal):-590.8MFE divergence-0.008