Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48440-AT3G17780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):B-cell receptor-associated 31-like
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.84394776097722
Log2 mRNA fold difference:-1.7191468906992
Log2 TE fold difference:0.86363227923808
Sequences
Protein sequence

MALQWLILSYVVAVEVVITLVLTLPYPMLLKKRVVQLVSLILQPAASIVAFAGFQLLDIY
WKAEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILLYWCIYRICKYNKDLERLE
ATEKRFKEE

MALQWLILSYVVAAEVAIAVILTLPYPMLLKKRIVSLISLILNPAASIVAFAGFQLLDIY
WKNEHRLLCSSEVCTTTERDRHEKSVYKAQRNGVLCAAGILLYWCIFRICKYHKDLERLE
QLEKRYKDE

Other information
Ka divergence:-0.369817KaKs divergence:0.999746
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):390Length 2 (bp):390Length divergence:0
MFE 1 (kcal):-104.4MFE 2 (kcal):-114.72MFE divergence0.047