Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48450-AT3G17800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF760)
Function (paralog2):Protein of unknown function (DUF760)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.43407734008326
Log2 mRNA fold difference:-0.23312145422255
Log2 TE fold difference:0.66637285674224
Sequences
Protein sequence

MDAVAANLFQSPSLLRQTSERLIFSTPNCPGFMRISSGPQFRLRQNSSLKFSRPFQSGTT
CVKSRRSFVVKASASGDASTESIAPLQLKSPVGQFLSQILVSHPHLVPAAVEQQLEQLQI
DRDAEEQSKDASSVLGTDIVLYRRIAEVKEKERRRALEEILYALVVQKFMDANVTLVPSI
TSSSADPSGRVDTWPTLDGELERLHSPEVYEMIQNHLSIILKNRTDDLTAVAQISKLGVG
QVYAASVMYGYFLKRIDQRFQLEKTMRILPGGSDEGETSIEQAGRDVERNFYEEAEETYQ
AVSSNQDVGSFVGGINASGGFSSDMKQSRLKTYVMSFDGETLQRYATIRSRESVGIIEKH
TEALFGRPEIVITPQGTIDSSKDEHIKISFKGLKRLVLEAVTFGSFLWDVESHVDSRYHF
VLN

MDALTSSLVRSPIVPSRTSDNGSGSMFLTASGPGFTRSGSSRLQLRLRVCPKSLQNASAR
SSRSLQSLTTTAKTRRSFVVRASSASNDASSGSSPKPIAPLQLQSPAGQFLSQILVSHPH
LVPAAVEQQLEQLQTDRDSQGQNKDSASVPGTDIVLYRRIAELKENERRRTLEEILYALV
VQKFMEANVSLVPSVSPSSDPSGRVDTWPTKVEKLERLHSPEMYEMIHNHLALILGSRMG
DLNSVAQISKLRVGQVYAASVMYGYFLKRVDQRFQLEKTMKILPGGSDESKTSVEQAEGT
ATYQAAVSSHPEVGAFAGGVSAKGFGSEIKPSRLRSYVMSFDAETLQRYATIRSREAVGI
IEKHTEALFGKPEIVITPEGTVDSSKDEQIKISFGGMKRLVLEAVTFGSFLWDVESHVDA
RYHFVLN

Other information
Ka divergence:-0.221291KaKs divergence:0.0504833
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):1272Length 2 (bp):1284Length divergence:0.005
MFE 1 (kcal):-401.8MFE 2 (kcal):-422.5MFE divergence0.025