Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48470-AT3G17820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutamine synthetase 1;5
Function (paralog2):glutamine synthetase 1.3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.9881414278009
Log2 mRNA fold difference:5.5492822215868
Log2 TE fold difference:-0.5817532169971
Sequences
Protein sequence

MTSPLSDLLNLDLSDTKKIIAEYIWIGGSGMDIRSKARTLPGPVSNPTKLPKWNYDGSST
DQAAGDDSEVILYPQAIFKDPFRKGNNILVMCDAYRPAGDPIPTNNRHKAVKIFDHPNVK
AEEPWFGIEQEYTLLKKDVKWPLGWPLGGFPGPQGPYYCAVGADKAFGRDIVDAHYKACL
YSGLSIGGANGEVMPGQWEFQISPTVGIGAGDQLWVARYILERITEICGVIVSFDPKPIQ
GDWNGAAAHTNFSTKSMRKDGGLDLIKEAIKKLEVKHKQHIAAYGEGNERRLTGKHETAD
INTFSWGVADRGASVRVGRDTEKEGKGYFEDRRPSSNMDPYLVTSMIAETTIL

MSLLSDLVNLNLTDATGKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSST
GQAAGEDSEVILYPQAIFKDPFRKGNNILVMCDAYTPAGDPIPTNKRHNAAKIFSHPDVA
KEEPWYGIEQEYTLMQKDVNWPIGWPVGGYPGPQGPYYCGVGADKAIGRDIVDAHYKACL
YAGIGISGINGEVMPGQWEFQVGPVEGISSGDQVWVARYLLERITEISGVIVSFDPKPVP
GDWNGAGAHCNYSTKTMRNDGGLEVIKKAIGKLQLKHKEHIAAYGEGNERRLTGKHETAD
INTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIAETTILG

Other information
Ka divergence:-0.442068KaKs divergence:0.350185
GC content 1 (%):45GC content 2 (%):50GC content divergence:0.053
Length 1 (bp):1062Length 2 (bp):1065Length divergence:0.001
MFE 1 (kcal):-321.14MFE 2 (kcal):-352.16MFE divergence0.046