Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48480-AT3G17840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):receptor-like kinase 1
Function (paralog2):receptor-like kinase 902

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.0374793352847
Log2 mRNA fold difference:-1.2626254617213
Log2 TE fold difference:0.34544685333979
Sequences
Protein sequence

MRVFFFPNSSMAILSVFLSLLLLSLPLPSTQDLNADRTALLSLRSAVGGRTFRWNIKQTS
PCNWAGVKCESNRVTALRLPGVALSGDIPEGIFGNLTQLRTLSLRLNALSGSLPKDLSTS
SNLRHLYLQGNRFSGEIPEVLFSLSHLVRLNLASNSFTGEISSGFTNLTKLKTLFLENNQ
LSGSIPDLDLPLVQFNVSNNSLNGSIPKNLQRFESDSFLQTSLCGKPLKLCPDEETVPSQ
PTSGGNRTPPSVEGSEEKKKKNKLSGGAIAGIVIGCVVGFALIVLILMVLCRKKSNKRSR
AVDISTIKQQEPEIPGDKEAVDNGNVYSVSAAAAAAMTGNGKASEGNGPATKKLVFFGNA
TKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFKEKIELVGA
MDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRSRIAIGAAR
GLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRATGYRAPEVT
DPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWRREVFDSEL
LSLATDEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKMENLRPYSGSDQVNEAD

MRLFFTPSMSNLSIFFSILLLSLPLPSIGDLAADKSALLSFRSAVGGRTLLWDVKQTSPC
NWTGVLCDGGRVTALRLPGETLSGHIPEGIFGNLTQLRTLSLRLNGLTGSLPLDLGSCSD
LRRLYLQGNRFSGEIPEVLFSLSNLVRLNLAENEFSGEISSGFKNLTRLKTLYLENNKLS
GSLLDLDLSLDQFNVSNNLLNGSIPKSLQKFDSDSFVGTSLCGKPLVVCSNEGTVPSQPI
SVGNIPGTVEGSEEKKKRKKLSGGAIAGIVIGCVVGLSLIVMILMVLFRKKGNERTRAID
LATIKHHEVEIPGEKAAVEAPENRSYVNEYSPSAVKAVEVNSSGMKKLVFFGNATKVFDL
EDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFKEKIEVVGAMDHENL
VPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRSGIALGAARGLDYLH
SQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRATGYRAPEVTDPRRVS
QKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWRNEVFDSELMSIETV
VSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQSGADRVG

www.000webhost.com

Other information
Ka divergence:-0.0763521KaKs divergence:0.0676347
GC content 1 (%):47GC content 2 (%):49GC content divergence:0.021
Length 1 (bp):1968Length 2 (bp):1944Length divergence:-0.006
MFE 1 (kcal):-661.77MFE 2 (kcal):-684.45MFE divergence0.017