Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48500-AT3G17860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):jasmonate-zim-domain protein 4
Function (paralog2):jasmonate-zim-domain protein 3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.9643903020665
Log2 mRNA fold difference:1.5876452372547
Log2 TE fold difference:0.35271958595311
Sequences
Protein sequence

MERDFLGLGSKLSPITVKEETNEDSAPSRGMMDWSFSSKVGSGPQFLSFGTSQQETRVNT
VNDHLLSSAAMDQNQRTYFSSLQEDRVFPGSSQQDQTTITVSMSEPNYINSFINHQHLGG
SPIMAPPVSVFPAPTTIRSSSKPLPPQLTIFYAGSVLVYQDIAPEKAQAIMLLAGNGPHA
KPVSQPKPQKLVHHSLPTTDPPTMPPSFLPSISYIVSETRSSGSNGVTGLGPTKTKASLA
STRNNQTAAFSMAPTVGLPQTRKASLARFLEKRKERVINVSPYYVDNKSSIDCRTLMSEC
VSCPPAHHLH

MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRH
RKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQ
SHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLT
IFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPS
FMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVA
LPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT

www.000webhost.com

Other information
Ka divergence:-0.00928372KaKs divergence:-0.0846121
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):933Length 2 (bp):1059Length divergence:0.063
MFE 1 (kcal):-237.73MFE 2 (kcal):-298.2MFE divergence0.113