Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48510-AT3G17910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Surfeit locus 1 cytochrome c oxidase biogenesis protein
Function (paralog2):Surfeit locus 1 cytochrome c oxidase biogenesis protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.2583549373632
Log2 mRNA fold difference:0.77460475204609
Log2 TE fold difference:0.48342476256466
Sequences
Protein sequence

MTKLVSKIFKRLISQSQYMSSSTTSNLPAASQTSNLESQLLSSAPPPAKKKRGSALLWYL
VGFTTYGLGETYKFLQTQVEHLDSRKQCLEMKPMKLNTTKDLDGLGFRRVVCKGIFDEQR
SIYVGPKPRSMSKSSEIGFYVITPLLPIPNEPNSMKSPILVNRGWVPSDWKENSLESLGT
GGLVAAAKESRKANKLLSSQQSLLSKFWYKLNNPMIVEDQVSRAMHVEVVGVVRKSETPG
IYTLVNYPSSLAWFYLDVPKLALAMGFGEDTMYIESTYTDMDESRTYPVPRDVENLTRSK
DIPLDYHLYTVLWHWSSLTCFIKASSILMRRLTKSDPIGVEPILIPISILVFICTKIYSL
RNLFCKIDTIGVGCVTKLDTGKVK

MATSLSKILTRSNTKRYWCSTTTSISASPSLPKQFWSRHFSAVADSSSSSSAALGSQSSS
SAPPQENKRGSKWSQLLLFLPGAITFGLGSWQIVRREEKFKTLEYQQQRLNMEPIKLNID
HPLDKNLNALEFRRVSCKGVFDEQRSIYLGPRSRSISGITENGFFVITPLMPIPGDLDSM
QSPILVNRGWVPRSWREKSQESAEAEFIANQSTKAKSPSNEPKSWWKFWSKTPVITKEHI
SAVKPVEVVGVIRGGENPSIFVPSNDPSTGQWFYVDVPAMARAVGLPENTIYVEDVHEHV
DRSRPYPVPKDINTLIRSKVMPQDHLNYSITWYSLSAAVTFMAYKRLKAKPVRR

www.000webhost.com

Other information
Ka divergence:-0.434915KaKs divergence:-0.747062
GC content 1 (%):40GC content 2 (%):46GC content divergence:0.07
Length 1 (bp):1155Length 2 (bp):1065Length divergence:-0.041
MFE 1 (kcal):-304.1MFE 2 (kcal):-317.01MFE divergence0.021