Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48540-AT3G17920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Outer arm dynein light chain 1 protein
Function (paralog2):Outer arm dynein light chain 1 protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.37353505737127
Log2 mRNA fold difference:-0.46687182162702
Log2 TE fold difference:0.83595809713748
Sequences
Protein sequence

MAIVTGDRYVEKLQKFLEDEAESLLEETMILKLNPAGLHYLHLRLDSLRELERMLSNAPV
DYLRAYVSDLGDYRALEQLRRILRILTSLKVVSTLPSPARDPTPLSLFPFGSLKVLELRR
CDLSTSPAKGLIELRHTLEKIICHNSTDALRHVFASRIAEITNSPEWNKLAVISCACNRL
VLMDESLQLLPAAESLDLSRNKFVKVDNLRRCTKLKHLDLGFNHLRTVSYLSQVSCHLVK
LVLRNNALTTLRGIENLKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVCCARW
YRAHVFSYVALPDELKLDGKQIGTREFWKRQIIVAHRQSEPASYGFYSPAREEDNEEGSC
NRKKKKICRLASIHSEAESTYVNSDHESATCDHENKENMKFNQEADIFGLISKVEHLKKE
RSVLWLREFKEWMDRSTEDFADVCKDSQGINLEKKYYTKIREISRHHGGGTPRYTSGSLR
ASRAKSYRKNLECNGSCVDHKAGMDYMKYVEGNETQKITDDISSISLQSTDRNQKHQECV
HDEMESLSVEPNDLLPTTLAKEKLAENGNMSTLDITQHMTGSTYPGSPPHYQKDVLYRRH
NLVEEILQLSADSYSVASSDSTSSCSEDDNYDSESEYSNHKEGRLTDLLNVNRLGKEILE
CTPKGTRFLGSQPENGSTIKTLRTDESMKETTTNFPSGLHNGKHGVNQTDRLVEKRKPIK
RFVSFQKEESCITNGEISLRSDADISDSGEDVCISDNFWENTLSRVCSSSSNRSIKFLGT
DRTLGVEEYFSAKLSVSSSQETCRTYMNCDLILQKGSTYKQREAVLLLSSQDKLYVLLVG
VTTDYEGSTLSVLCSHEIKDLQDVSVGLGLQFVRLRFLEDVEYIFVTKCIKKTTELLNIT
QVFDSQATEYKCSLQSLENIQVDLFEKEICGGLKLSIFQYNVLHFQSTTRGEVSWLLRSL
FVAGRRLFICSEDFTQLSSRTAYSSSAPYFLLDSCCSISEISEMIIETQGIVVSLKIKEK
RTVDLVTWKLKWCSIENAIKFAALLKALHPNSPQWPLAVRYRR

MAIVTGDRYLENLQRFLDEKADLLIDGTDVLKLNPAGLHYVHLRLESLRELELMLSGAPV
DYLRAYVSDIGDFRALEQLRRILRLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLELRG
CDLSTSSAKGLLELRHTLEKLICHNSTDALRHVFASRIAEIKDSPQWNKLAFISCACNRL
VLMDESLQLLPAVESLDLSRNKFAKVDNLRRCNKLKHLDLGFNQLRKISHLSEVSCHLVK
LVLRNNALTTLRGIENLKSLEGLDVSFNLISDFSELEFLGSLSFLTDLWLEGNPICCARW
YRAHVLSYVYLPNDLKLDGKHIGNREFWKRQVVVTRRKSQPASYGFYSPARDEADDEGSF
TRKKTKIYRLASIDSEEESTYVNSDQESASCEPETQSKEENIKSDHEADVFGLICKVEQL
KKERSVLWLREFKEWIDHPSEDFVDVSKNGSSTDSEQKYYMKNRNGPKHHGETMRYTPGP
LPSFQITDLNQKHQAFFLDGKPDENGNMSTLDASQDMTGSFSPSSPPHYQKDVLHRRQNL
VEEILQISADSYSVASSDSSCSENENYDSEQSNPEQDTLKDHLSGNRGEDTSLLDSQPEK
SSIIKSWKIEDSFKAKTTNFLSGLHKSELASGVNQIYRWFDKKQSKRKPKKRNVSPLEEY
SFIKKGETSHRSDADIIDSCEDEYISDHFQEGSLTTGCNSKRSTRFLETEKSLEGMGGLV
EEFFTTTLSDSSNDETCRIYVSCDCILQQESTYKQREVVLLLSSQEKLYVLLVGVSTDLQ
ESSLSLLCSHTIGDIRDVSVGLGLQVVRLRFREDAEYIFMTASIEKTTVLLNIIKFLDYQ
VTESKFSLKSLENVQVELFEKEICSGLKLSIFQYIVLHFQSSTFGEVSWLPRSLFVAGGH
LFICNEDFRQLSFLPTDDASSSPYFSLDSSCSISDIFEMVVESRGSSCLSLKVKQKDSTF
QSSQKRTVNSVTWKLKLLSPECVPKFVALVNGLHPDSTEFPLFVRHLGER

www.000webhost.com

Other information
Ka divergence:-0.187333KaKs divergence:0.105416
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):3192Length 2 (bp):3033Length divergence:-0.026
MFE 1 (kcal):-953.67MFE 2 (kcal):-924.37MFE divergence-0.016