Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48620-AT3G18035
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):high mobility group A5
Function (paralog2):winged-helix DNA-binding transcription factor family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0042013657456
Log2 mRNA fold difference:1.1639820140634
Log2 TE fold difference:-0.14438383483038
Sequences
Protein sequence

MDPSLSATNDPHHPPPPQFTSFPPFTNTNPFASPNHPFFTGPTAVAPPNNIHLYQAAPPQ
QPQTSPVPPHPSISHPPYSDMICTAIAALNEPDGSSKQAISRYIERIYTGIPTAHGALLT
HHLKTLKTSGILVMVKKSYKLASTPPPPPPTSVAPSLEPPRSDFIVNENQPLPDPVLASS
TPQTIKRGRGRPPKAKPDVVQPQPLTNGKLTWEQSELPVSRPEEIQIQPPQLPLQPQQPV
KRPPGRPRKDGTSPTVKPAASVSGGVETVKRRGRPPSGRAAGRERKPIVVSAPASVFPYV
ANGGVRRRGRPKRVDAGGASSVAPPPPPPTNVESGGEEVAVKKRGRGRPPKIGGVIRKPM
KPMRSFARTGKPVGRPRKNAVSVGASGRQDGDYGELKKKFELFQARAKDIVIVLKSEIGG
SGNQAVVQAIQDLEGIAETTNEPKHMEEVQLPDEEHLETEPEAEGQGQTEAEAMQEALF

MDPSLGDPHHPPQFTPFPHFPTSNHHPLGPNPYNNHVVFQPQPQTQTQIPQPQMFQLSPH
VSMPHPPYSEMICAAIAALNEPDGSSKMAISRYIERCYTGLTSAHAALLTHHLKTLKTSG
VLSMVKKSYKIAGSSTPPASVAVAAAAAAQGLDVPRSEILHSSNNDPMASGSASQPLKRG
RGRPPKPKPESQPQPLQQLPPTNQVQANGQPIWEQQQVQSPVPVPTPVTESAKRGPGRPR
KNGSAAPATAPIVQASVMAGIMKRRGRPPGRRAAGRQRKPKSVSSTASVYPYVANGARRR
GRPRRVVDPSSIVSVAPVGGENVAAVAPGMKRGRGRPPKIGGVISRLIMKPKRGRGRPVG
RPRKIGTSVTTGTQDSGELKKKFDIFQEKVKEIVKVLKDGVTSENQAVVQAIKDLEALTV
TETVEPQVMEEVQPEETAAPQTEAQQTEAAETQGGQEEGQEREGETQTQTEAEAMQEALF

www.000webhost.com

Other information
Ka divergence:-0.0758196KaKs divergence:-0.200243
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):1440Length 2 (bp):1443Length divergence:0.001
MFE 1 (kcal):-457.64MFE 2 (kcal):-466.32MFE divergence0.009