Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48660-AT1G48670
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Auxin-responsive GH3 family protein
Function (paralog2):auxin-responsive GH3 family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.75654275354209
Log2 mRNA fold difference:3.6167828219672
Log2 TE fold difference:-2.7637430337176
Sequences
Protein sequence

MSLSVELKDLEVLTTNAKQIQDDVLKEILTLNANTEYLKRFLDGSSDKELFKKNVPVVSY
NDVKPYIERVANGEPSDVISGGTITRFVQSTGTSGGIHKIFPVNDKYIENLGYLLAVSSL
ITSNDKVDEKGKKMAFLYNRLESKTPSGLALSSSFTSYFMSDYFKNRSSKCNSEYTSPDQ
VILCPDNNQSVYCHLLCGLSQREKVVGVSATFAHALIKAINALQIYWKELSSNIRSGHVS
EWITDLDCKNAVSAILGGPDPELADVIEQECSHKSWEGIITRLWPKAKFIECIVTGQMAQ
YIPTLDFYSNKLPIVSMVYGSSESIFGVNVDPLSKPQDVSYTFLPNISYFEFLPIDHEED
MNTIVDLVGVKLGCYYETVVTSYFGLHRYLIGDILQVTGFYNNTPQFRFVRRKNIVLSVN
SEATTEQDILKGLASATLVLESSNSMLTGFTCYADISSFPGHYVFYWELKAKDVDDVVEL
DENVLEECCYALEESFDALYKRLRSKEGSIGALEIKVVQQGTFDSLMEYFISKGGSVAQY
KTPMCINSSETLAVLEDKVIARFYSQKSPPLNL

MMNPSLNLMDLEELTSNAKQIQEDVLEEILTLNANTEYLHRFLHGSSDKVLFKKNVPVVT
YDDVKPYIERVANGEPSDVISGGPITMFLRSTGTSGGKQKVFPVNDKYIEKLGYVIALRS
LAMSKHFDSGGEQGKAMEFHCTKPPSATPSGLPRDEVVRVGAAFAFVLVRAIDFLEKHWK
ELCSNIRSGHVSEWITDLEGRNAVSTILRGPDSILADVIEQECSHKSWEGIITRLWPKAK
YIDCIITGQMSQYIPMLEFYSNKLPIVSTTYGSSESTFGMNVDPLCKPQDTSYTCAPNIS
YFEFLPVDHKGDMASIVDLVDVKLGCYYEPVVTNYFGLHRYLIGDILQVTGFYNNTPQFR
FVHRKNVVLSVRSETTTEEDILKALNHVGLVLESSDLMLMGFTCYADISTFPGHYVFYWE
LKAKDVQDVFELEEKVMVKCCSLLEESFDEVYRKNRSKDECIGPLEIRVVQQGTFDSLME
YFISQGGSIAQYKTPICINSSEALAVLENKVLARFFSEKSPPLDS

www.000webhost.com

Other information
Ka divergence:-0.0937583KaKs divergence:0.524519
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):1722Length 2 (bp):1578Length divergence:-0.044
MFE 1 (kcal):-477.13MFE 2 (kcal):-445.77MFE divergence-0.034