Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48750-AT3G18280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Function (paralog2):Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.043777900349546
Log2 mRNA fold difference:-1.0480440618532
Log2 TE fold difference:1.1113927919817
Sequences
Protein sequence

MVKVMWVSVLALAAAILLLTVPVAEGVTCSPMQLASCAAAMTSSSPPSEACCTKLREQQP
CLCGYMRNPTLRQYVSSPNARKVSNSCKIPSPSC

MVMIKTTMVSLFALAAVLLMILAPAAEAVTCSPMQLSPCATAITSSSPPSALCCAKLKEQ
RPCLCGYMRNPSLRRFVSTPNARKVSKSCKLPIPRC

www.000webhost.com

Other information
Ka divergence:0.275127KaKs divergence:-0.991819
GC content 1 (%):56GC content 2 (%):52GC content divergence:-0.037
Length 1 (bp):285Length 2 (bp):291Length divergence:0.01
MFE 1 (kcal):-116.5MFE 2 (kcal):-89.55MFE divergence-0.131