Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48770-AT3G18295
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1639)
Function (paralog2):Protein of unknown function (DUF1639)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.75868029206422
Log2 mRNA fold difference:0.74688450337501
Log2 TE fold difference:0.089414244066207
Sequences
Protein sequence

MEPPFERSKRLHNFSLPQLRWGQQRFLRCVNLPSPPPSSSSPDHAATNRSVSIAGVSLTR
GGGGGAKNGEVVAAAKPWNLRMRRAACSEPGEEIEIGVNKRRSIIDNEDGGGDKKNEKSK
FSIALSRDEIEQDFSFVFGKKPPKRPKKRPRLVQKKLNTIFPGLWLNEEEVTIDSYNGA

MELPPPPERSKRLHNFTLPYLRWGQQRFLRCVKLPHHNRSPSFPSSSSSPSPDHRSHNGG
LSGELRLDLVYDANRPKLSVLGNGGDNNNGDVVAAARPWNLRTRRAACNEPPGDDSTRII
ESSSSLRRHEIGVKRGGSEDGGDSQQNKNEKVKFSVSLLREEIEQDFSALIGKRPPRRPK
KRPRLVQKQMNTLFPGLWLAEEVTADSYDVPEAVET

www.000webhost.com

Other information
Ka divergence:-0.391215KaKs divergence:-0.7345
GC content 1 (%):43GC content 2 (%):47GC content divergence:0.044
Length 1 (bp):540Length 2 (bp):651Length divergence:0.093
MFE 1 (kcal):-169.7MFE 2 (kcal):-204.02MFE divergence0.092