Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G48780-AT3G18300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.99396544028774
Log2 mRNA fold difference:-0.59934377915975
Log2 TE fold difference:-0.40896526972483
Sequences
Protein sequence

MICTEALQRISFSSDLGQSDKAPPPVIEPSGLIRRDETLLDSSNSDFEFHISNSFDPGDS
SPADEIFADGMILPFHVTAASTVPKRLYKYELPPITSSLSPSPLSPQPLPTKHSEKETNG
RASGANSDSEAEKSSKSFWSFKRSSSLNCDIKKSLICSFPRLTRSNSTGSVTNSKRAMLR
DVNNHRPSSRSSCCNAYQFRPQKHTGKKGEGGGSFSVIPVLNGPSTFGLGSILRHSNSKD
KTKTKKKKNKK

MICTESNHQRFSFAGDLGQSDKGTPMEQQPSGPVRRDTTLLDSSNSDFEFHISSNFDPGD
SSPADEIFADGMILPVLPFQVTATSTMPKRLYKYELPPIVSAPTLSSYLPPLPLPLPEHS
RKYSVKETRGSLNGRGSGANSDSEAEKSSKSFWSFKRSSSLNCDIKKSLICSFPRLTRSN
STGSVAISKREMLRDINKHSSQRHGVPRPGVNPSSHMRPPSSFCCSSYQFRPQKHAGKNG
GGRGGSFWIAPVIGGPSPFGLGSILRLTKEKKKK

Other information
Ka divergence:-0.0358676KaKs divergence:-0.820891
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):756Length 2 (bp):825Length divergence:0.044
MFE 1 (kcal):-205.69MFE 2 (kcal):-257.74MFE divergence0.112